| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Anti-sigma-G factor Gin (Protein CsfB) |
| NCBI Accession ID | M96156.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 218 |
| Right | 412 |
| Strand | + |
| Nucleotide Sequence | ATGGACGAAACAGTTAAACTTAATCATACATGTGTGATTTGTGATCAAGAGAAGAATAGAGGCATTCATCTTTATACGAAATTCATATGCTTAGATTGTGAGAGAAAAGTAATTTCTACATCAACTTCTGATCCTGACTATGCGTTTTACGTAAAAAAACTAAAGAGCATTCATACACCGCCATTATATTCATAG |
| Sequence | MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYAFYVKKLKSIHTPPLYS |
| Source of smORF | Swiss-Prot |
| Function | An anti-sigma-G factor, prevents premature activation of sigma-G factor in the forespore; overexpression leads to 1000-fold reduction in spore formation, spore formation stops after engulfment (Pubmed:17921305, Pubmed:19497328). Overexpression also inhibits sigma-G transcription activation activity (Pubmed:18208527). When both Gin and sigma-G are expressed in E.coli Gin inhibits sigma-G, strongly suggesting Gin inhibits by direct physical interaction (Pubmed:19497328). {ECO:0000269|Pubmed:17921305, ECO:0000269|Pubmed:18208527, ECO:0000269|Pubmed:19497328}. |
| Pubmed ID | 7584024 9384377 8759874 17921305 18208527 19497328 |
| Domain | CDD:402409 |
| Functional Category | Metal-binding |
| Uniprot ID | P37534 |
| ORF Length (Amino Acid) | 64 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 35531 | 35725 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 35207 | 35401 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 171368 | 171562 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 15778 | 15972 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 35195 | 35389 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1974017 | 1974211 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 35208 | 35402 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3894685 | 3894879 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 36668 | 36862 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 66433 | 66624 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 39833 | 40024 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 39675 | 39866 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 1593817 | 1593978 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 14557 | 14718 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 1510762 | 1510923 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 39032 | 39208 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 17 | 36304 | 36507 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 18 | 2055243 | 2055431 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 19 | 4153917 | 4154126 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 20 | 2536734 | 2536937 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 21 | 2476858 | 2477019 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 22 | 1858228 | 1858419 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 23 | 48063 | 48248 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 24 | 46175 | 46366 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 25 | 1479415 | 1479606 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02575.18 | 0.96 | 24 | 6718.0 | same-strand | YbaB/EbfC DNA-binding family |
| 2 | PF13662.8 | 0.96 | 24 | 6107.0 | same-strand | Toprim domain |
| 3 | PF02132.17 | 0.96 | 24 | 6107.0 | same-strand | RecR protein |
| 4 | PF01751.24 | 1.0 | 25 | 6109 | same-strand | Toprim domain |
| 5 | PF10704.11 | 0.96 | 24 | 5863.0 | same-strand | Protein of unknown function (DUF2508) |
| 6 | PF07441.13 | 0.96 | 24 | 5532.5 | same-strand | SigmaK-factor processing regulatory protein BofA |
| 7 | PF10112.11 | 0.6 | 15 | 133 | same-strand | 5-bromo-4-chloroindolyl phosphate hydrolysis protein |
| 8 | PF05816.13 | 0.6 | 15 | 766 | same-strand | Toxic anion resistance protein (TelA) |
| 9 | PF02223.19 | 1.0 | 25 | 3315 | same-strand | Thymidylate kinase |
| 10 | PF13521.8 | 0.8 | 20 | 3360.0 | same-strand | AAA domain |
| 11 | PF06153.13 | 1.0 | 25 | 4028 | same-strand | Cyclic-di-AMP receptor |