Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YaaL |
NCBI Accession ID | D26185.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 93081 |
Right | 93305 |
Strand | + |
Nucleotide Sequence | ATGGGTTTTCTTCGCAAGAAAACATTAAGAAGAGAGTTTGATGAAAAACTAACCGAGCAGCTTTTTAAGCAAAAGGAAGAGTGGAACAGGCAAAAAAAGCTGGTTGAAAAAAGCTTAGAACCGTCTGCTGAAGTGTTATACGAACTGAAAGTAGCTGAAGCGAAGTATTTTTTTTACTTAAGGGAAGCGAAGCAGCGAAATTTAAAAATCAGCCGGTGGAAGTAA |
Sequence | MGFLRKKTLRREFDEKLTEQLFKQKEEWNRQKKLVEKSLEPSAEVLYELKVAEAKYFFYLREAKQRNLKISRWK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10704. Profile Description: Protein of unknown function (DUF2508). This family is conserved in Firmicutes. Several members are annotated as being the protein YaaL. The function is not known. |
Pubmed ID | 2124672 7584024 9384377 1577688 |
Domain | CDD:402372 |
Functional Category | Others |
Uniprot ID | P37533 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 14717 | 14941 | + | NZ_CP013984.1 | Bacillus inaquosorum |
2 | 29481 | 29705 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 29145 | 29369 | + | NZ_CP048852.1 | Bacillus tequilensis |
4 | 29089 | 29313 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 1979963 | 1980187 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 29233 | 29457 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 165267 | 165491 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 3900621 | 3900845 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 30702 | 30926 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 33758 | 33982 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
11 | 60349 | 60573 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 33626 | 33850 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
13 | 1516789 | 1517013 | - | NZ_CP043404.1 | Bacillus safensis |
14 | 1599844 | 1600068 | - | NZ_CP017786.1 | Bacillus xiamenensis |
15 | 590283 | 590507 | + | NZ_CP011150.1 | Bacillus altitudinis |
16 | 4160951 | 4161172 | - | NZ_CP016020.1 | Bacillus weihaiensis |
17 | 5091530 | 5091751 | - | NZ_CP040336.1 | Bacillus luti |
18 | 27782 | 28003 | + | NZ_CP064875.1 | Bacillus toyonensis |
19 | 27778 | 27999 | + | NZ_CP032365.1 | Bacillus wiedmannii |
20 | 28314 | 28535 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
21 | 28184 | 28405 | + | NC_011725.1 | Bacillus cereus B4264 |
22 | 28178 | 28399 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
23 | 1061912 | 1062130 | + | NZ_CP017703.1 | Aeribacillus pallidus |
24 | 2061771 | 2061989 | - | NZ_CP022983.1 | Cytobacillus kochii |
25 | 29971 | 30195 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
26 | 2722827 | 2723051 | + | NZ_CP061470.1 | Geobacillus zalihae |
27 | 242938 | 243162 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
28 | 2367704 | 2367928 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
29 | 3199677 | 3199901 | - | NZ_CP014342.1 | Geobacillus subterraneus |
30 | 159629 | 159853 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
31 | 584887 | 585087 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
32 | 32537 | 32752 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
33 | 17745 | 17969 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
34 | 3159980 | 3160204 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
35 | 27510 | 27731 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
36 | 141610 | 141828 | + | NZ_CP053989.1 | Niallia circulans |
37 | 2470567 | 2470785 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
38 | 453325 | 453549 | - | NZ_CP070511.1 | Parageobacillus toebii |
39 | 1508729 | 1508950 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00857.22 | 0.67 | 26 | 3750.5 | opposite-strand | Isochorismatase family |
2 | PF14437.8 | 1.0 | 39 | 3145 | same-strand | MafB19-like deaminase |
3 | PF00383.25 | 1.0 | 39 | 3145 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
4 | PF13177.8 | 1.0 | 39 | 980.0 | same-strand | DNA polymerase III, delta subunit |
5 | PF12169.10 | 1.0 | 39 | 979 | same-strand | DNA polymerase III subunits gamma and tau domain III |
6 | PF00004.31 | 1.0 | 39 | 980 | same-strand | ATPase family associated with various cellular activities (AAA) |
7 | PF02575.18 | 1.0 | 39 | 630 | same-strand | YbaB/EbfC DNA-binding family |
8 | PF13662.8 | 1.0 | 39 | 19 | same-strand | Toprim domain |
9 | PF02132.17 | 1.0 | 39 | 19 | same-strand | RecR protein |
10 | PF01751.24 | 1.0 | 39 | 19 | same-strand | Toprim domain |
11 | PF07441.13 | 1.0 | 39 | 79 | same-strand | SigmaK-factor processing regulatory protein BofA |
12 | PF10764.11 | 0.95 | 37 | 5904 | same-strand | Inhibitor of sigma-G Gin |