Result : P37525

Protein Information

• Protein name: Extracellular matrix regulatory protein B (Regulator of the extracellular matrix B)
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 4567
• Right: 4812
• Strand: +
• Nucleotide Sequence: TTGTATATTCATTTAGGTGATGACTTTGTGGTTTCAACACGAGATATTGTCGGCATTTTTGACTTTAAAGCCAACATGTCGCCTATTGTTGAAGAATTTCTGAAAAAACAGAAACACAAGGTGGTGCCTTCCGTAAACGGCACGCCCAAATCTATCGTAGTCACGGTTCAGAATATATATTACTCTCCCTTATCTTCCAGCACATTAAAAAAACGTGCGCAATTTATGTTTGAAATAGATTCTTAG
• Sequence: MYIHLGDDFVVSTRDIVGIFDFKANMSPIVEEFLKKQKHKVVPSVNGTPKSIVVTVQNIYYSPLSSSTLKKRAQFMFEIDS
• Source of smORF: Swiss-Prot
• Function: Regulates the biosynthesis of the extracellular matrix and the biofilm formation. May act as an enhancer of biofilm gene expression. Acts in parallel to the pathway that governs SinR derepression. {ECO:0000269|Pubmed:19363116}.
• Pubmed ID: 2987847 7584024 9384377 19383706 19363116
• Domain: CDD:412637
• Functional Category: Others
• Uniprot ID: P37525
• ORF Length (Amino Acid): 81

Conservation Analysis

No. of Species: 17

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4163	4408	+	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
2	4124070	4124315	+	NZ_CP013984.1	Bacillus inaquosorum
3	4567	4812	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
4	140295	140540	+	NZ_CP033052.1	Bacillus vallismortis
5	4160	4405	+	NZ_CP048852.1	Bacillus tequilensis
6	2004808	2005053	-	NZ_CP029364.1	Bacillus halotolerans
7	4364	4609	+	NZ_CP051464.1	Bacillus mojavensis
8	3926731	3926976	-	NZ_CP011937.1	Bacillus velezensis
9	4568	4813	+	NZ_CP053376.1	Bacillus amyloliquefaciens
10	4170	4412	+	NZ_LT603683.1	Bacillus glycinifermentans
11	4690	4932	+	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
12	31318	31560	+	NZ_CP023665.1	Bacillus paralicheniformis
13	1640272	1640517	-	NZ_CP017786.1	Bacillus xiamenensis
14	4187	4432	+	NZ_CP011150.1	Bacillus altitudinis
15	1544631	1544876	-	NZ_CP043404.1	Bacillus safensis
16	4188971	4189219	-	NZ_CP016020.1	Bacillus weihaiensis
17	4828	5073	+	NC_022524.1	Bacillus infantis NRRL B-14911

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP034943.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00308.20	0.94	16	2824.5	same-strand	Bacterial dnaA protein
2	PF08299.13	0.94	16	2824.5	same-strand	Bacterial dnaA protein helix-turn-helix
3	PF11638.10	0.94	16	2824.5	same-strand	DnaA N-terminal domain
4	PF00004.31	0.94	16	2824.5	same-strand	ATPase family associated with various cellular activities (AAA)
5	PF00712.21	1.0	17	1498	same-strand	DNA polymerase III beta subunit, N-terminal domain
6	PF02767.18	1.0	17	1498	same-strand	DNA polymerase III beta subunit, central domain
7	PF02768.17	1.0	17	1498	same-strand	DNA polymerase III beta subunit, C-terminal domain
8	PF13275.8	1.0	17	1146	same-strand	S4 domain
9	PF02463.21	1.0	17	18	same-strand	RecF/RecN/SMC N terminal domain
10	PF00204.27	1.0	17	52	same-strand	DNA gyrase B
11	PF00986.23	1.0	17	52	same-strand	DNA gyrase B subunit, carboxyl terminus
12	PF02518.28	1.0	17	52	same-strand	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
13	PF01751.24	1.0	17	52	same-strand	Toprim domain
14	PF00521.22	1.0	17	2184	same-strand	DNA gyrase/topoisomerase IV, subunit A
15	PF03989.15	1.0	17	2184	same-strand	DNA gyrase C-terminal domain, beta-propeller
16	PF14175.8	0.88	15	10049	opposite-strand	YaaC-like Protein
17	PF00478.27	0.82	14	11110.5	same-strand	IMP dehydrogenase / GMP reductase domain
18	PF00571.30	0.82	14	11110.5	same-strand	CBS domain