Protein Information |
Information Type | Description |
---|---|
Protein name | Extracellular matrix regulatory protein B (Regulator of the extracellular matrix B) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 4567 |
Right | 4812 |
Strand | + |
Nucleotide Sequence | TTGTATATTCATTTAGGTGATGACTTTGTGGTTTCAACACGAGATATTGTCGGCATTTTTGACTTTAAAGCCAACATGTCGCCTATTGTTGAAGAATTTCTGAAAAAACAGAAACACAAGGTGGTGCCTTCCGTAAACGGCACGCCCAAATCTATCGTAGTCACGGTTCAGAATATATATTACTCTCCCTTATCTTCCAGCACATTAAAAAAACGTGCGCAATTTATGTTTGAAATAGATTCTTAG |
Sequence | MYIHLGDDFVVSTRDIVGIFDFKANMSPIVEEFLKKQKHKVVPSVNGTPKSIVVTVQNIYYSPLSSSTLKKRAQFMFEIDS |
Source of smORF | Swiss-Prot |
Function | Regulates the biosynthesis of the extracellular matrix and the biofilm formation. May act as an enhancer of biofilm gene expression. Acts in parallel to the pathway that governs SinR derepression. {ECO:0000269|Pubmed:19363116}. |
Pubmed ID | 2987847 7584024 9384377 19383706 19363116 |
Domain | CDD:412637 |
Functional Category | Others |
Uniprot ID | P37525 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4163 | 4408 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
2 | 4124070 | 4124315 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 4567 | 4812 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
4 | 140295 | 140540 | + | NZ_CP033052.1 | Bacillus vallismortis |
5 | 4160 | 4405 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 2004808 | 2005053 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 4364 | 4609 | + | NZ_CP051464.1 | Bacillus mojavensis |
8 | 3926731 | 3926976 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 4568 | 4813 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 4170 | 4412 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 4690 | 4932 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 31318 | 31560 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 1640272 | 1640517 | - | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 4187 | 4432 | + | NZ_CP011150.1 | Bacillus altitudinis |
15 | 1544631 | 1544876 | - | NZ_CP043404.1 | Bacillus safensis |
16 | 4188971 | 4189219 | - | NZ_CP016020.1 | Bacillus weihaiensis |
17 | 4828 | 5073 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00308.20 | 0.94 | 16 | 2824.5 | same-strand | Bacterial dnaA protein |
2 | PF08299.13 | 0.94 | 16 | 2824.5 | same-strand | Bacterial dnaA protein helix-turn-helix |
3 | PF11638.10 | 0.94 | 16 | 2824.5 | same-strand | DnaA N-terminal domain |
4 | PF00004.31 | 0.94 | 16 | 2824.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
5 | PF00712.21 | 1.0 | 17 | 1498 | same-strand | DNA polymerase III beta subunit, N-terminal domain |
6 | PF02767.18 | 1.0 | 17 | 1498 | same-strand | DNA polymerase III beta subunit, central domain |
7 | PF02768.17 | 1.0 | 17 | 1498 | same-strand | DNA polymerase III beta subunit, C-terminal domain |
8 | PF13275.8 | 1.0 | 17 | 1146 | same-strand | S4 domain |
9 | PF02463.21 | 1.0 | 17 | 18 | same-strand | RecF/RecN/SMC N terminal domain |
10 | PF00204.27 | 1.0 | 17 | 52 | same-strand | DNA gyrase B |
11 | PF00986.23 | 1.0 | 17 | 52 | same-strand | DNA gyrase B subunit, carboxyl terminus |
12 | PF02518.28 | 1.0 | 17 | 52 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
13 | PF01751.24 | 1.0 | 17 | 52 | same-strand | Toprim domain |
14 | PF00521.22 | 1.0 | 17 | 2184 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
15 | PF03989.15 | 1.0 | 17 | 2184 | same-strand | DNA gyrase C-terminal domain, beta-propeller |
16 | PF14175.8 | 0.88 | 15 | 10049 | opposite-strand | YaaC-like Protein |
17 | PF00478.27 | 0.82 | 14 | 11110.5 | same-strand | IMP dehydrogenase / GMP reductase domain |
18 | PF00571.30 | 0.82 | 14 | 11110.5 | same-strand | CBS domain |