| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YycD |
| NCBI Accession ID | D26185.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 7001 |
| Right | 7201 |
| Strand | + |
| Nucleotide Sequence | ATGATAAAGAAATATGCGATTACACCTAATGTTGATGCGGACGGCTGGTTTATTGAGGTGGAGAATGTAGCGCCGACAGCTTTGTATACGTCTAAAGACGCCGCTATTGAAAAGGCCAAACAGGTGGCTAAGGAAAACAGTCCGTCTAAGCTTGTAATTTATGACCAGTTTAAAAATGTGGAAGAAGAACACTCATTTTAA |
| Sequence | MIKKYAITPNVDADGWFIEVENVAPTALYTSKDAAIEKAKQVAKENSPSKLVIYDQFKNVEEEHSF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23970. Profile Description: Uncharacterized protein conserved in bacteria (DUF2188). This domain, found in various hypothetical bacterial proteins, has no known function. |
| Pubmed ID | 7584024 9384377 |
| Domain | CDD:390205 |
| Functional Category | Others |
| Uniprot ID | P37480 |
| ORF Length (Amino Acid) | 66 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4159005 | 4159205 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 4061677 | 4061877 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 84951 | 85151 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3998970 | 3999170 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3955705 | 3955905 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 2083977 | 2084177 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3970853 | 3971053 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 60784 | 60981 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3967269 | 3967466 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 673507 | 673704 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 11 | 2644617 | 2644826 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 12 | 1872304 | 1872501 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 13 | 2697291 | 2697488 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02518.28 | 0.62 | 8 | 5311.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 2 | PF00512.27 | 0.62 | 8 | 5311.5 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 3 | PF00672.27 | 0.62 | 8 | 5311.5 | opposite-strand | HAMP domain |
| 4 | PF13426.9 | 0.62 | 8 | 5311.5 | opposite-strand | PAS domain |
| 5 | PF00072.26 | 0.69 | 9 | 4594 | opposite-strand | Response regulator receiver domain |
| 6 | PF00486.30 | 0.69 | 9 | 4594 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 7 | PF00709.23 | 0.69 | 9 | 2280 | opposite-strand | Adenylosuccinate synthetase |
| 8 | PF00903.27 | 0.69 | 9 | 1653 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 9 | PF03796.17 | 0.69 | 9 | 170 | opposite-strand | DnaB-like helicase C terminal domain |
| 10 | PF00772.23 | 0.69 | 9 | 170 | opposite-strand | DnaB-like helicase N terminal domain |
| 11 | PF13481.8 | 0.69 | 9 | 170 | opposite-strand | AAA domain |
| 12 | PF14174.8 | 0.69 | 9 | 370 | same-strand | YycC-like protein |