Result : P37135
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 11.0 kDa protein in cwlL 5'region |
| NCBI Accession ID | |
| Organism | Bacillus licheniformis |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRTGGLREMSQTNEYEVFQKEIKEIKADQKTLEKRVSTLERTSERHDQQIISINEKLNKIEENTTWIKRSITGAIITAVSTGIIGGAIAVFYNLLQK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10779. Profile Description: Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it. |
| Pubmed ID | 7902527 |
| Domain | CDD:402419 |
| Functional Category | Others |
| Uniprot ID | P37135 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1402069 | 1402362 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 2 | 3369355 | 3369648 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 3 | 1445675 | 1445962 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 4 | 3208736 | 3209029 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 5 | 1374909 | 1375178 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 6 | 3841791 | 3842084 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 7 | 1343749 | 1344018 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 8 | 3433649 | 3433942 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 1459557 | 1459850 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 1355473 | 1355742 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 11 | 638969 | 639238 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 12 | 1346755 | 1347000 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 13 | 1262789 | 1263067 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 14 | 1515753 | 1516022 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 15 | 1316580 | 1316849 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 16 | 1001375 | 1001644 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 17 | 2611661 | 2611912 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 18 | 1320135 | 1320404 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 19 | 2691355 | 2691597 | - | NZ_CP011937.1 | Bacillus velezensis |
| 20 | 1269656 | 1269898 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029364.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04688.15 | 1.0 | 13 | 15.0 | same-strand | SPP1 phage holin |
| 2 | PF01471.20 | 1.0 | 13 | 305.0 | same-strand | Putative peptidoglycan binding domain |
| 3 | PF01510.27 | 0.92 | 12 | 291.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 4 | PF01476.22 | 0.85 | 11 | 289 | same-strand | LysM domain |
| 5 | PF09693.12 | 0.69 | 9 | 493.5 | same-strand | Phage uncharacterised protein (Phage XkdX) |
| 6 | PF14185.8 | 0.69 | 9 | 1441 | opposite-strand | Antitoxin SpoIISB, type II toxin-antitoxin system |
| 7 | PF14171.8 | 0.69 | 9 | 1611 | opposite-strand | Toxin SpoIISA, type II toxin-antitoxin system |
++ More..