Result : P36690
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | X72787.1 |
| Organism | Streptomyces griseus |
| Left | 1032 |
| Right | 1319 |
| Strand | + |
| Nucleotide Sequence | GTGACGGACGCCGTGGGCTCCATCGACATGCCTGATGCTGAGGATGAAGCTCCCGAGTCGAAGAAGAAGTCTCGGAAGGGCGGCAAGCGCGGCAAGAAGGGCCCTCTGGGTCGGCTCGCGCTGTTCTACCGCCAGATCGTCGCCGAACTCCGTAAGGTTGTCTGGCCGACGCGCAGCCAGCTCACGACGTACACCTCCGTGGTGATCGTGTTCGTCGTCGTCATGATCGGTCTTGTTACCGTTCTCGACATCGGCTTCGCCCGGGTCGTCAAGTACGTCTTCGGCTGA |
| Sequence | MTDAVGSIDMPDAEDEAPESKKKSRKGGKRGKKGPLGRLALFYRQIVAELRKVVWPTRSQLTTYTSVVIVFVVVMIGLVTVLDIGFARVVKYVFG |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}. |
| Pubmed ID | 8039667 8286423 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | P36690 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 95
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3379755 | 3380042 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 2 | 4301073 | 4301360 | + | NZ_CP022310.1 | Streptomyces calvus |
| 3 | 3994268 | 3994555 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 4 | 5166327 | 5166614 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 5 | 4581674 | 4581958 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 6 | 3586519 | 3586803 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 7 | 3693246 | 3693530 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 8 | 3998796 | 3999083 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 9 | 4237794 | 4238078 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 10 | 6016432 | 6016719 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 11 | 4725376 | 4725660 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 12 | 4721888 | 4722175 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 13 | 6558913 | 6559206 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 14 | 4825435 | 4825722 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 15 | 4571216 | 4571503 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 16 | 4918205 | 4918492 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 17 | 772650 | 772937 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 18 | 7466867 | 7467157 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 19 | 5635789 | 5636076 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 20 | 4747260 | 4747544 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 21 | 5343904 | 5344191 | + | NZ_CP027306.1 | Streptomyces atratus |
| 22 | 3674139 | 3674423 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 23 | 4610788 | 4611075 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 24 | 3108934 | 3109221 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 25 | 3660551 | 3660835 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 26 | 3846788 | 3847075 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 27 | 4002307 | 4002594 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 28 | 9216822 | 9217109 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 29 | 4026438 | 4026725 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 30 | 4832314 | 4832601 | + | NZ_CP070242.1 | Streptomyces californicus |
| 31 | 4892658 | 4892945 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 32 | 3594997 | 3595278 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 33 | 5597306 | 5597593 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 34 | 854998 | 855285 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 35 | 3756123 | 3756410 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 36 | 4659045 | 4659329 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 37 | 5055889 | 5056173 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 38 | 4939213 | 4939500 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 39 | 4252277 | 4252564 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 40 | 2811736 | 2812023 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 41 | 4199869 | 4200159 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 42 | 4564324 | 4564611 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 43 | 5266199 | 5266486 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 44 | 2662233 | 2662511 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 45 | 5704276 | 5704563 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 46 | 4523382 | 4523666 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 47 | 5586867 | 5587151 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 48 | 4529675 | 4529962 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 49 | 5226772 | 5227056 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 50 | 5416805 | 5417089 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 51 | 6024812 | 6025096 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 52 | 3005052 | 3005339 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 53 | 6268157 | 6268444 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 54 | 4440235 | 4440516 | + | NZ_CP029043.1 | Streptomyces nigra |
| 55 | 4302411 | 4302692 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 56 | 5964712 | 5964999 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 57 | 5392252 | 5392533 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 58 | 6437691 | 6437978 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 59 | 5576590 | 5576877 | + | NZ_CP022685.1 | Streptomyces formicae |
| 60 | 4198432 | 4198719 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 61 | 4231702 | 4231983 | + | NC_020990.1 | Streptomyces albidoflavus |
| 62 | 4530112 | 4530393 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 63 | 581897 | 582178 | + | NZ_CP030862.1 | Streptomyces globosus |
| 64 | 3503092 | 3503388 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 65 | 4232738 | 4233034 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 66 | 1057417 | 1057659 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 67 | 2793523 | 2793807 | - | NZ_CP031194.1 | Streptomyces paludis |
| 68 | 3625365 | 3625661 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 69 | 3894330 | 3894626 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 70 | 3985942 | 3986238 | - | NZ_CP023691.1 | Streptomyces platensis |
| 71 | 2964442 | 2964735 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 72 | 4129419 | 4129703 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 73 | 5027270 | 5027554 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 74 | 4634316 | 4634612 | - | NZ_CP070326.1 | Streptomyces noursei |
| 75 | 4839651 | 4839932 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 76 | 4703824 | 4704105 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 77 | 3265232 | 3265513 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 78 | 3165132 | 3165413 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 79 | 5174891 | 5175184 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 80 | 3773816 | 3774121 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 81 | 4058364 | 4058645 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 82 | 3333001 | 3333288 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 83 | 3525058 | 3525345 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 84 | 4665390 | 4665680 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 85 | 3033990 | 3034265 | - | NZ_CP013745.1 | Arthrobacter alpinus |
| 86 | 3299977 | 3300267 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 87 | 328759 | 329031 | + | NZ_CP016282.1 | Cryobacterium arcticum |
| 88 | 2154052 | 2154324 | - | NZ_CP030033.1 | Cryobacterium soli |
| 89 | 2247117 | 2247356 | - | NZ_CP025227.1 | Actinomyces wuliandei |
| 90 | 3374888 | 3375130 | - | NZ_CP043661.1 | Kribbella qitaiheensis |
| 91 | 757580 | 757843 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 92 | 4954322 | 4954564 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 93 | 2764108 | 2764410 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 94 | 868593 | 868889 | + | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
| 95 | 1634249 | 1634506 | + | NZ_CP041694.1 | Cellulosimicrobium cellulans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010572.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00466.22 | 0.62 | 59 | 3743 | same-strand | Ribosomal protein L10 |
| 2 | PF00687.23 | 1.0 | 95 | 1661 | same-strand | Ribosomal protein L1p/L10e family |
| 3 | PF03946.16 | 1.0 | 95 | 1136 | same-strand | Ribosomal protein L11, N-terminal domain |
| 4 | PF00298.21 | 1.0 | 95 | 1136 | same-strand | Ribosomal protein L11, RNA binding domain |
| 5 | PF02357.21 | 1.0 | 95 | 78 | same-strand | Transcription termination factor nusG |
| 6 | PF00155.23 | 0.98 | 93 | 419 | opposite-strand | Aminotransferase class I and II |
| 7 | PF00962.24 | 0.94 | 89 | 1801 | opposite-strand | Adenosine deaminase |
| 8 | PF02873.18 | 0.85 | 81 | 3394 | same-strand | UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain |
| 9 | PF01565.25 | 0.85 | 81 | 3394 | same-strand | FAD binding domain |
++ More..