Result : P36253
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | X76134.1 |
| Organism | Staphylococcus carnosus (strain TM300) |
| Left | 113 |
| Right | 310 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAAGATAAGAAAAAAGCACCTAAAGATAGTTTCTTTAAAGGCGTTATATCTGAGATGGAGAAGACAAGTTGGCCAACTAAAGAAGAAATATTAAAATATACAACTATTGTAATTGTGACAGTAGTATTCTTCCTGATCTTCTTCTATGCCTTAGATTTGGGAATCGGTAAATTGATAGAATTAATTAGTTAA |
| Sequence | MAEDKKKAPKDSFFKGVISEMEKTSWPTKEEILKYTTIVIVTVVFFLIFFYALDLGIGKLIELIS |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}. |
| Pubmed ID | 8181706 19060169 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | P36253 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 77
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2446671 | 2446868 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 2 | 2675835 | 2676032 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 3 | 6613 | 6810 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 4 | 2267431 | 2267610 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 5 | 1566993 | 1567172 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 6 | 2394225 | 2394404 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 7 | 332504 | 332683 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 8 | 1217461 | 1217655 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 9 | 2266878 | 2267057 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 10 | 236288 | 236488 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 11 | 688316 | 688516 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 214989 | 215168 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 13 | 2326073 | 2326252 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 14 | 537671 | 537853 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 15 | 517733 | 517915 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 16 | 2253387 | 2253566 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 17 | 2400728 | 2400907 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 18 | 2277707 | 2277886 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 19 | 372813 | 372992 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 20 | 2274279 | 2274461 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 21 | 2404149 | 2404331 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 22 | 542232 | 542414 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 23 | 1113936 | 1114118 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 24 | 2194142 | 2194324 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 25 | 1730275 | 1730457 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 26 | 246593 | 246772 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 27 | 2251872 | 2252051 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 28 | 2342413 | 2342595 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 29 | 2642549 | 2642725 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 30 | 1545429 | 1545608 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 31 | 242407 | 242586 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 32 | 1561401 | 1561580 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 33 | 1268362 | 1268547 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 34 | 367509 | 367679 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 35 | 398310 | 398489 | - | NZ_CP027770.1 | Staphylococcus felis |
| 36 | 244321 | 244500 | + | NZ_LR134483.1 | Listeria grayi |
| 37 | 1510904 | 1511080 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 38 | 90759 | 90935 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 39 | 1427978 | 1428154 | - | NZ_CP043404.1 | Bacillus safensis |
| 40 | 500818 | 500991 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 41 | 1176662 | 1176835 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 42 | 2716680 | 2716862 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 43 | 1969633 | 1969803 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 44 | 2023865 | 2024044 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 45 | 109400 | 109579 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 46 | 110271 | 110450 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 47 | 5010043 | 5010222 | - | NZ_CP040336.1 | Bacillus luti |
| 48 | 103957 | 104136 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 49 | 109318 | 109497 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 50 | 126902 | 127078 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 51 | 3812874 | 3813044 | - | NZ_CP011937.1 | Bacillus velezensis |
| 52 | 118498 | 118668 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 53 | 410953 | 411138 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 54 | 109600 | 109779 | + | NC_011725.1 | Bacillus cereus B4264 |
| 55 | 253533 | 253703 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 56 | 117481 | 117651 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 57 | 117246 | 117416 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 58 | 1892001 | 1892171 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 59 | 87258 | 87428 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 60 | 117541 | 117711 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 61 | 232536 | 232718 | + | NZ_CP053989.1 | Niallia circulans |
| 62 | 1635985 | 1636164 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 63 | 2239655 | 2239834 | - | NZ_CP047361.1 | Macrococcus canis |
| 64 | 117367 | 117537 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 65 | 113583 | 113762 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 66 | 124951 | 125121 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 67 | 111255 | 111413 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 68 | 1784116 | 1784289 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 69 | 116492 | 116671 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 70 | 149003 | 149182 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 71 | 2458042 | 2458224 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 72 | 310584 | 310763 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 73 | 248149 | 248328 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 74 | 121107 | 121286 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 75 | 219175 | 219354 | + | NZ_LT906444.1 | Listeria welshimeri |
| 76 | 263535 | 263714 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 77 | 1082013 | 1082186 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 78 | 1774084 | 1774254 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018776.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00542.21 | 0.88 | 68 | 2913.5 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 2 | PF16320.7 | 0.88 | 68 | 2913.5 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
| 3 | PF00466.22 | 0.99 | 76 | 2367.5 | same-strand | Ribosomal protein L10 |
| 4 | PF00687.23 | 0.99 | 76 | 1405.0 | same-strand | Ribosomal protein L1p/L10e family |
| 5 | PF03946.16 | 0.99 | 76 | 866 | same-strand | Ribosomal protein L11, N-terminal domain |
| 6 | PF00298.21 | 0.99 | 76 | 867.0 | same-strand | Ribosomal protein L11, RNA binding domain |
| 7 | PF02357.21 | 0.99 | 76 | 119.0 | same-strand | Transcription termination factor nusG |
| 8 | PF00467.31 | 0.96 | 74 | 117 | same-strand | KOW motif |
| 9 | PF08281.14 | 0.64 | 49 | 293 | same-strand | Sigma-70, region 4 |
| 10 | PF04542.16 | 0.82 | 63 | 294.5 | same-strand | Sigma-70 region 2 |
| 11 | PF05991.13 | 0.99 | 76 | 987 | same-strand | YacP-like NYN domain |
| 12 | PF00588.21 | 0.99 | 76 | 1514 | same-strand | SpoU rRNA Methylase family |
| 13 | PF08032.14 | 0.99 | 76 | 1514 | same-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 14 | PF00636.28 | 0.99 | 76 | 2255 | same-strand | Ribonuclease III domain |
| 15 | PF01406.21 | 0.84 | 65 | 2664.0 | same-strand | tRNA synthetases class I (C) catalytic domain |
| 16 | PF09190.13 | 0.84 | 65 | 2664.0 | same-strand | DALR domain |
++ More..