Result : P35874
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | Z11839.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 835 |
| Right | 1032 |
| Strand | + |
| Nucleotide Sequence | ATGGAGAAACTCCGAAAGTTCTTCAGGGAAGTCATCGCCGAAGCAAAGAAAATTTCCTGGCCCTCCCGAAAGGAGTTGCTCACTTCTTTTGGTGTTGTTCTCGTGATACTCGCTGTTACAAGTGTTTATTTTTTTGTGCTTGATTTCATCTTCTCGGGAGTTGTGAGTGCGATTTTCAAAGCGCTGGGAATAGGATAA |
| Sequence | MEKLRKFFREVIAEAKKISWPSRKELLTSFGVVLVILAVTSVYFFVLDFIFSGVVSAIFKALGIG |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. |
| Pubmed ID | 1429627 10360571 18923516 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | P35874 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 228921 | 229118 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 460660 | 460857 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 3 | 470768 | 470965 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 213977 | 214174 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 832030 | 832227 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 6 | 498126 | 498323 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 7 | 491288 | 491485 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 8 | 1238563 | 1238751 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 9 | 392902 | 393099 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 10 | 753272 | 753469 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 11 | 643370 | 643558 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 12 | 679322 | 679510 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 13 | 1785497 | 1785694 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 14 | 1266259 | 1266447 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 15 | 926388 | 926579 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 16 | 586988 | 587185 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013642.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18298.3 | 1.0 | 16 | 12.0 | same-strand | NusG additional domain |
| 2 | PF00467.31 | 1.0 | 16 | 12.0 | same-strand | KOW motif |
| 3 | PF03946.16 | 1.0 | 16 | 1121.0 | same-strand | Ribosomal protein L11, N-terminal domain |
| 4 | PF00298.21 | 1.0 | 16 | 1121.0 | same-strand | Ribosomal protein L11, RNA binding domain |
| 5 | PF00687.23 | 1.0 | 16 | 1570.0 | same-strand | Ribosomal protein L1p/L10e family |
| 6 | PF00466.22 | 0.69 | 11 | 2413 | same-strand | Ribosomal protein L10 |
| 7 | PF00542.21 | 0.69 | 11 | 2968 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 8 | PF16320.7 | 0.69 | 11 | 2968 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
++ More..