Result : P35153
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpuE (ORFX5) |
| NCBI Accession ID | L09228.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8132 |
| Right | 8284 |
| Strand | + |
| Nucleotide Sequence | ATGATGAGCCGCTATGCAAAATGTTTAAAAATGCATAGTGTTATTTCCTATTGCGTAAAATACCTAAAGCCCCGAATTTTTTATAAATTCGGGGCTTTTTTGACGGTAAATAACAAAAGAGGGGAGGGAAACAAATGGAAGAGTATTATATGA |
| Sequence | MMSRYAKCLKMHSVISYCVKYLKPRIFYKFGAFLTVNNKRGEGNKWKSII |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7934829 2112225 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P35153 |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2431325 | 2431477 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2391678 | 2391830 | - | NZ_CP033052.1 | Bacillus vallismortis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13508.9 | 1.0 | 2 | 3546.5 | same-strand | Acetyltransferase (GNAT) domain |
| 2 | PF00885.21 | 1.0 | 2 | 2969.0 | same-strand | 6,7-dimethyl-8-ribityllumazine synthase |
| 3 | PF00926.21 | 1.0 | 2 | 1740.0 | same-strand | 3,4-dihydroxy-2-butanone 4-phosphate synthase |
| 4 | PF00925.22 | 1.0 | 2 | 1740.0 | same-strand | GTP cyclohydrolase II |
| 5 | PF00677.19 | 1.0 | 2 | 1078.0 | same-strand | Lumazine binding domain |
| 6 | PF01872.19 | 1.0 | 2 | -18.0 | same-strand | RibD C-terminal domain |
| 7 | PF00383.25 | 1.0 | 2 | -18.0 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 8 | PF10502.11 | 1.0 | 2 | 841.0 | same-strand | Signal peptidase, peptidase S26 |
| 9 | PF09855.11 | 1.0 | 2 | 1884.5 | same-strand | Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082) |
++ More..