Result : P35104
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-800-850 alpha chain D (Antenna pigment protein alpha chain D) (LH II-D alpha) |
| NCBI Accession ID | X64959.1 |
| Organism | Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) |
| Left | 169 |
| Right | 348 |
| Strand | + |
| Nucleotide Sequence | ATGAATCAAGGTCGTATCTGGACTGTCGTGAAGCCGACCGTCGGTCTCCCGCTGCTGCTCGGCAGCGTCGCCATCATGGTCTTCCTGGTCCACTTCGCTGTGCTGACGCACACCACCTGGGTCGCGAAGTTCATGAACGGTAAGGCTGCTGCGATCGAGAGCTCGATCAAGGCCGTCTAA |
| Sequence | MNQGRIWTVVKPTVGLPLLLGSVAIMVFLVHFAVLTHTTWVAKFMNGKAAAIESSIKAV |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 2670551 14704707 |
| Domain | CDD:395441 |
| Functional Category | Metal-binding |
| Uniprot ID | P35104 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2897372 | 2897551 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 2 | 1569116 | 1569295 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 3 | 2233590 | 2233772 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 4 | 1644713 | 1644868 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP058907.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00556.22 | 1.0 | 3 | 38 | same-strand | Antenna complex alpha/beta subunit |
| 2 | PF00072.26 | 0.67 | 2 | 2831 | opposite-strand | Response regulator receiver domain |
| 3 | PF00196.21 | 0.67 | 2 | 1813.5 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 4 | PF08281.14 | 0.67 | 2 | 1813.5 | opposite-strand | Sigma-70, region 4 |
| 5 | PF00360.22 | 0.67 | 2 | 1148.0 | opposite-strand | Phytochrome region |
| 6 | PF01590.28 | 0.67 | 2 | 1148.0 | opposite-strand | GAF domain |
| 7 | PF08446.13 | 0.67 | 2 | 1148.0 | opposite-strand | PAS fold |
| 8 | PF07730.15 | 0.67 | 2 | 1148.0 | opposite-strand | Histidine kinase |
| 9 | PF02518.28 | 0.67 | 2 | 1782 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 10 | PF03209.17 | 0.67 | 2 | 142.0 | same-strand | PUCC protein |
++ More..