Result : P34159
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein CA_C3713 |
| NCBI Accession ID | X65276.1 |
| Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
| Left | 1567 |
| Right | 1857 |
| Strand | + |
| Nucleotide Sequence | ATGGCTCAAATATCTGTAACACCTGAAGAGTTAAAATCTCAAGCTCAGGTTTATATTCAATCTAAAGAAGAAATCGATCAAGCAATTCAAAAAGTAAATTCAATGAATAGCACAATCGCTGAGGAATGGAAAGGACAAGCCTTCCAAGCGTATTTGGAACAATACAATCAACTTCATCAAACTGTTGTTCAGTTTGAAAACCTTCTTGAGAGCGTAAATCAACAATTGAACAAATACGCAGATACTGTTGCTGAACGTGATGCACAAGATGCTCAAAGCTTCGGTTTCTAA |
| Sequence | MAQISVTPEELKSQAQVYIQSKEEIDQAIQKVNSMNSTIAEEWKGQAFQAYLEQYNQLHQTVVQFENLLESVNQQLNKYADTVAERDAQDAQSFGF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313; |
| Pubmed ID | 8501044 11466286 24586681 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | P34159 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3919985 | 3920275 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 2 | 1014163 | 1014453 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 3 | 1075030 | 1075320 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 4 | 446249 | 446539 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 5 | 786679 | 786969 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 6 | 1318767 | 1319057 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 7 | 1876739 | 1877029 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 8 | 118847 | 119137 | + | NZ_CP028130.1 | Rathayibacter iranicus |
| 9 | 2378704 | 2378994 | - | NZ_CP028130.1 | Rathayibacter iranicus |
| 10 | 1935134 | 1935424 | - | NZ_CP028130.1 | Rathayibacter iranicus |
| 11 | 796916 | 797206 | - | NZ_CP028130.1 | Rathayibacter iranicus |
| 12 | 2894237 | 2894527 | - | NZ_CP028130.1 | Rathayibacter iranicus |
| 13 | 1367626 | 1367916 | + | NZ_CP028130.1 | Rathayibacter iranicus |
| 14 | 572627 | 572917 | + | NZ_CP028130.1 | Rathayibacter iranicus |
| 15 | 415370 | 415660 | + | NZ_CP028129.1 | Rathayibacter rathayi |
| 16 | 1545299 | 1545589 | + | NZ_CP028129.1 | Rathayibacter rathayi |
| 17 | 2757828 | 2758118 | - | NZ_CP028129.1 | Rathayibacter rathayi |
| 18 | 2511912 | 2512202 | - | NZ_CP028129.1 | Rathayibacter rathayi |
| 19 | 1250860 | 1251150 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 20 | 429455 | 429745 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 21 | 2927379 | 2927672 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 22 | 2616181 | 2616474 | - | NZ_CP065211.1 | Enterococcus lactis |
| 23 | 769075 | 769368 | + | NZ_CP023011.2 | Enterococcus hirae |
| 24 | 878544 | 878837 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 25 | 16452 | 16745 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 26 | 25618 | 25911 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 27 | 35783 | 36076 | + | NZ_CP014699.1 | Streptococcus pantholopis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015687.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01580.20 | 0.77 | 10 | 1894 | same-strand | FtsK/SpoIIIE family |
| 2 | PF10140.11 | 0.85 | 11 | 763 | same-strand | WXG100 protein secretion system (Wss), protein YukC |
| 3 | PF08817.12 | 0.85 | 11 | 516.5 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
++ More..