Result : P33997
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-binding transcriptional activator AlpA (Prophage CP4-57 regulatory protein AlpA) |
| NCBI Accession ID | U03737.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 2780 |
| Right | 2992 |
| Strand | + |
| Nucleotide Sequence | ATGAACAATCGATCGGCCGTTAGAATACTACGGTTACCAGCGGTTATCCAAAAAACAGGTATGGCACGGGCCACCATCTATGACTGGTTGAACCCCAAATCACCACGATACGATGCCACCTTTCCCAAAAAGCGAATGCTCGGCGTGAAATCTGTCGGATGGATTGAGGCCGAGATTGATGAGTGGTTATCACAACGCTGTAAACTTATTTGA |
| Sequence | MNNRSAVRILRLPAVIQKTGMARATIYDWLNPKSPRYDATFPKKRMLGVKSVGWIEAEIDEWLSQRCKLI |
| Source of smORF | Swiss-Prot |
| Function | Positive regulator of the expression of the slpA gene (Pubmed:7511582). When overexpressed, leads to suppression of the capsule overproduction and UV sensitivity phenotypes of cells mutant for the Lon ATP-dependent protease (Pubmed:7511582). Part of the cryptic P4-like prophage CP4-57 (Pubmed:7511583). Overexpression of AlpA leads to excision of the CP4-57 prophage by IntA. This inactivates ssrA (the gene upstream of the prophage) that encodes tmRNA which is required to rescue stalled ribosomes in a process known as trans-translation (Pubmed:7511583). {ECO:0000269|Pubmed:7511582, ECO:0000269|Pubmed:7511583}. |
| Pubmed ID | 7511582 9278503 16738553 7511583 |
| Domain | CDD:413393 |
| Functional Category | DNA-binding |
| Uniprot ID | P33997 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2758644 | 2758856 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4568156 | 4568344 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 3 | 2375044 | 2375256 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 4 | 1210207 | 1210419 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 5 | 3881642 | 3881845 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 6 | 4324435 | 4324629 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 7 | 3355554 | 3355769 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 8 | 5338922 | 5339140 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 9 | 4807524 | 4807733 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 10 | 1340716 | 1340925 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 11 | 1571719 | 1571922 | - | NZ_LS483422.1 | Providencia heimbachae |
| 12 | 882630 | 882800 | - | NZ_CP023525.1 | Cedecea neteri |
| 13 | 1714243 | 1714413 | + | NZ_CP009787.1 | Yersinia rohdei |
| 14 | 2591829 | 2592002 | + | NZ_LS483470.1 | Leminorella richardii |
| 15 | 953363 | 953551 | - | NZ_CP026047.1 | Raoultella planticola |
| 16 | 2304248 | 2304430 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 17 | 2648906 | 2649109 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 18 | 2536027 | 2536227 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 19 | 5405468 | 5405647 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 20 | 130224 | 130427 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 21 | 124970 | 125203 | + | NZ_CP061280.1 | Mannheimia bovis |
++ More..