| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein in rpoN-murA intergenic region (ORF3) |
| NCBI Accession ID | L26051.1 |
| Organism | Acinetobacter guillouiae (Acinetobacter genomosp. 11) |
| Left | 2590 |
| Right | 2841 |
| Strand | + |
| Nucleotide Sequence | ATGAATAGTGAACAGCTCACTGAAATCTTAAAAGCAGCTTTTCCTGATGCTGAAGTTGCTGTCAGTGGACAAGCAGGTAAATTTGACCTCCGTATTGTCGACAATCAGTTTGAAGGGAAACGTCCTGTTCCTCGTCAACAAGCTGTTTACGCGCCACTTAATTCTTATATTGCCAGTGGTGAGGTACATGCGGTAACTATTCGTGCAATGACTAAAGAAGAATGGCGCAAAGCCAGTATGTTTGGAGCTTAA |
| Sequence | MNSEQLTEILKAAFPDAEVAVSGQAGKFDLRIVDNQFEGKRPVPRQQAVYAPLNSYIASGEVHAVTIRAMTKEEWRKASMFGA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00386. Profile Description: BolA-like protein. transcriptional regulator BolA; Provisional |
| Pubmed ID | 8206826 |
| Domain | CDD:412350 |
| Functional Category | Others |
| Uniprot ID | P33989 |
| ORF Length (Amino Acid) | 83 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3810807 | 3811058 | - | NZ_AP014630.1 | Acinetobacter guillouiae |
| 2 | 2928659 | 2928910 | - | NZ_CP032134.1 | Acinetobacter chinensis |
| 3 | 750526 | 750777 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 4 | 2543468 | 2543719 | - | NZ_CP071766.1 | Acinetobacter towneri |
| 5 | 2802182 | 2802433 | - | NZ_CP035934.2 | Acinetobacter cumulans |
| 6 | 3400033 | 3400284 | - | NZ_CP065820.1 | Acinetobacter seifertii |
| 7 | 258177 | 258428 | - | NZ_CP012808.1 | Acinetobacter equi |
| 8 | 683944 | 684195 | + | NZ_CP024632.1 | Acinetobacter junii |
| 9 | 653782 | 654033 | + | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 10 | 1379558 | 1379809 | - | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 11 | 2794464 | 2794715 | - | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 12 | 2376902 | 2377153 | - | NZ_CP041970.1 | Acinetobacter dispersus |
| 13 | 601945 | 602196 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 14 | 3280082 | 3280333 | - | NZ_CP015121.1 | Acinetobacter baumannii |
| 15 | 3198294 | 3198545 | - | NZ_CP016895.1 | Acinetobacter larvae |
| 16 | 832662 | 832913 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 17 | 2685619 | 2685870 | - | NZ_CP049916.1 | Acinetobacter lanii |
| 18 | 3790874 | 3791125 | + | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 19 | 3288775 | 3289026 | - | NZ_CP053391.1 | Acinetobacter lactucae |
| 20 | 1254363 | 1254614 | - | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 21 | 3473295 | 3473546 | - | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 22 | 598869 | 599120 | + | NZ_CP045650.1 | Acinetobacter wanghuae |
| 23 | 157003 | 157251 | + | NZ_CP031222.1 | Aquirhabdus parva |
| 24 | 2970545 | 2970790 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 25 | 2699304 | 2699549 | - | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 26 | 2353814 | 2354059 | - | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 27 | 213657 | 213902 | + | NZ_CP011158.1 | Moraxella ovis |
| 28 | 2591470 | 2591700 | - | NZ_CP011797.1 | Reinekea forsetii |
| 29 | 2060455 | 2060706 | - | NZ_CP045871.1 | Litoricola lipolytica |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00155.23 | 0.9 | 26 | 3587.5 | same-strand | Aminotransferase class I and II |
| 2 | PF00815.22 | 1.0 | 29 | 2171 | same-strand | Histidinol dehydrogenase |
| 3 | PF01634.20 | 1.0 | 29 | 1264 | same-strand | ATP phosphoribosyltransferase |
| 4 | PF00275.22 | 1.0 | 29 | 7 | same-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
| 5 | PF02482.21 | 0.79 | 23 | 139 | same-strand | Sigma 54 modulation protein / S30EA ribosomal protein |
| 6 | PF04552.15 | 0.79 | 23 | 646 | same-strand | Sigma-54, DNA binding domain |
| 7 | PF04963.15 | 0.79 | 23 | 646 | same-strand | Sigma-54 factor, core binding domain |
| 8 | PF00309.22 | 0.79 | 23 | 646 | same-strand | Sigma-54 factor, Activator interacting domain (AID) |