Result : P33762
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein BB_0439 |
| NCBI Accession ID | U04527.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 4281 |
| Right | 4580 |
| Strand | + |
| Nucleotide Sequence | ATGAATGATTCTGCTTTTAAAAAAATAGGCAATGTTCTTAAGGATTATTTAGAATCCAATTTGCTTGTTAATAAAAAAATAAGTTCGAAATTATTGATTGCCGATAAATGGAATCAGATATTTGAGGCTTTATCAGATGATGTAAAGTTTTTAGATTTTAAAAATGAGCAGATCCTTTTTCTTGAGGTAAGCAATTCAAGTATTTTGTGTAGTATAGCAATCAATAAGTCGAAGATAATAAATTCAGTAAAAGAATTAACAGGTATTAAAATAATAGATATAAAGGTTTTGGTAAGGTAA |
| Sequence | MNDSAFKKIGNVLKDYLESNLLVNKKISSKLLIADKWNQIFEALSDDVKFLDFKNEQILFLEVSNSSILCSIAINKSKIINSVKELTGIKIIDIKVLVR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8341609 9403685 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P33762 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 458349 | 458648 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 460841 | 461140 | + | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 462289 | 462588 | + | NZ_CP028861.1 | Borreliella garinii |
| 4 | 457924 | 458223 | + | NZ_CP044535.1 | Borrelia maritima |
| 5 | 478932 | 479231 | + | NC_011244.1 | Borrelia recurrentis A1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015921.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02195.20 | 0.8 | 4 | 7597.0 | opposite-strand | ParB-like nuclease domain |
| 2 | PF17762.3 | 0.8 | 4 | 7597.0 | opposite-strand | HTH domain found in ParB protein |
| 3 | PF00521.22 | 1.0 | 5 | 5048 | opposite-strand | DNA gyrase/topoisomerase IV, subunit A |
| 4 | PF03989.15 | 1.0 | 5 | 5048 | opposite-strand | DNA gyrase C-terminal domain, beta-propeller |
| 5 | PF00204.27 | 1.0 | 5 | 3132 | opposite-strand | DNA gyrase B |
| 6 | PF00986.23 | 1.0 | 5 | 3132 | opposite-strand | DNA gyrase B subunit, carboxyl terminus |
| 7 | PF02518.28 | 1.0 | 5 | 3132 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 8 | PF01751.24 | 1.0 | 5 | 3132 | opposite-strand | Toprim domain |
| 9 | PF00308.20 | 1.0 | 5 | 1488 | same-strand | Bacterial dnaA protein |
| 10 | PF08299.13 | 1.0 | 5 | 1488 | same-strand | Bacterial dnaA protein helix-turn-helix |
| 11 | PF11638.10 | 1.0 | 5 | 1488 | same-strand | DnaA N-terminal domain |
| 12 | PF00004.31 | 1.0 | 5 | 1488 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 13 | PF00712.21 | 1.0 | 5 | 91 | same-strand | DNA polymerase III beta subunit, N-terminal domain |
| 14 | PF02767.18 | 1.0 | 5 | 91 | same-strand | DNA polymerase III beta subunit, central domain |
| 15 | PF02768.17 | 1.0 | 5 | 91 | same-strand | DNA polymerase III beta subunit, C-terminal domain |
| 16 | PF00468.19 | 0.8 | 4 | 92.0 | same-strand | Ribosomal protein L34 |
| 17 | PF00825.20 | 1.0 | 5 | 228 | same-strand | Ribonuclease P |
| 18 | PF02096.22 | 1.0 | 5 | 574 | same-strand | 60Kd inner membrane protein |
| 19 | PF14804.8 | 1.0 | 5 | 2221 | same-strand | Jag N-terminus |
| 20 | PF13083.8 | 1.0 | 5 | 2221 | same-strand | KH domain |
| 21 | PF01370.23 | 1.0 | 5 | 2995 | same-strand | NAD dependent epimerase/dehydratase family |
| 22 | PF16363.7 | 1.0 | 5 | 2995 | same-strand | GDP-mannose 4,6 dehydratase |
| 23 | PF07993.14 | 1.0 | 5 | 2995 | same-strand | Male sterility protein |
++ More..