| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein CA_C1697 |
| NCBI Accession ID | Z23079.1 |
| Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
| Left | 3046 |
| Right | 3309 |
| Strand | + |
| Nucleotide Sequence | ATGGATTTACCATCACATTCAATAAATGCTATGAAGTCCATGGAAGTAATAGATATCAATACAGGAACAAAACTTGGGCTTATTAAAGATTTAAAAATTGATACTGAAGAATACAAGGTTATATCGATAATACTTCCTGGTTCAAAGGTAGGAGGATGGTTTTCAAAAGGAAATGATATAGAAATCGATTGGACAGACATACAGAAAATAGGCGTAGATGTAATACTTGTGAACGGTGACAATTTATTTGTAAATAAGGATTGA |
| Sequence | MDLPSHSINAMKSMEVIDINTGTKLGLIKDLKIDTEEYKVISIILPGSKVGGWFSKGNDIEIDWTDIQKIGVDVILVNGDNLFVNKD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21591. Profile Description: N/A. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain. |
| Pubmed ID | 7961408 11466286 |
| Domain | CDD:419751 |
| Functional Category | Others |
| Uniprot ID | P33660 |
| ORF Length (Amino Acid) | 87 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1850179 | 1850442 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 2 | 2272665 | 2272928 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 3 | 1811406 | 1811672 | + | NZ_CP014176.1 | Clostridium argentinense |
| 4 | 1145469 | 1145741 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 5 | 1338931 | 1339200 | + | NZ_CP043998.1 | Clostridium diolis |
| 6 | 883244 | 883459 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 7 | 2617342 | 2617563 | - | NZ_CP028842.1 | Clostridium botulinum |
| 8 | 1468571 | 1468810 | + | NZ_CP014204.2 | Clostridium baratii |
| 9 | 2233187 | 2233450 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 10 | 2875747 | 2875968 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 11 | 92164 | 92382 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 12 | 1131049 | 1131267 | + | NZ_CP020953.1 | Clostridium drakei |
| 13 | 3136951 | 3137169 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 14 | 2547685 | 2547906 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 15 | 3571481 | 3571702 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 16 | 1335426 | 1335647 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 17 | 1722295 | 1722513 | + | NZ_CP040924.1 | Clostridium thermarum |
| 18 | 1103145 | 1103402 | + | NZ_CP030775.1 | Clostridium butyricum |
| 19 | 1518854 | 1519117 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 20 | 1218474 | 1218701 | - | NZ_CP016786.1 | Clostridium isatidis |
| 21 | 1381079 | 1381303 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 22 | 1394155 | 1394418 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 23 | 242747 | 242980 | - | NZ_CP023671.1 | Clostridium septicum |
| 24 | 2254520 | 2254747 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 25 | 1548077 | 1548292 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 26 | 1222230 | 1222463 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 27 | 1866685 | 1866906 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 28 | 1140718 | 1140939 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 29 | 1449244 | 1449468 | - | NC_008593.1 | Clostridium novyi NT |
| 30 | 1749604 | 1749855 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02491.22 | 0.77 | 23 | 3975 | same-strand | SHS2 domain inserted in FTSA |
| 2 | PF14450.8 | 0.77 | 23 | 3975 | same-strand | Cell division protein FtsA |
| 3 | PF00091.27 | 0.93 | 28 | 2849.0 | same-strand | Tubulin/FtsZ family, GTPase domain |
| 4 | PF12327.10 | 0.93 | 28 | 2849.0 | same-strand | FtsZ family, C-terminal domain |
| 5 | PF03419.15 | 1.0 | 30 | 1755.5 | same-strand | Sporulation factor SpoIIGA |
| 6 | PF04542.16 | 1.0 | 30 | 881 | same-strand | Sigma-70 region 2 |
| 7 | PF04545.18 | 1.0 | 30 | 881 | same-strand | Sigma-70, region 4 |
| 8 | PF08281.14 | 0.67 | 20 | 166.0 | same-strand | Sigma-70, region 4 |
| 9 | PF03477.18 | 0.97 | 29 | 77 | same-strand | ATP cone domain |
| 10 | PF02578.17 | 0.87 | 26 | 700.5 | same-strand | Multi-copper polyphenol oxidoreductase laccase |
| 11 | PF00072.26 | 0.87 | 26 | 1443.5 | same-strand | Response regulator receiver domain |
| 12 | PF00486.30 | 0.87 | 26 | 1443.5 | same-strand | Transcriptional regulatory protein, C terminal |
| 13 | PF02518.28 | 0.9 | 27 | 2142 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 14 | PF00512.27 | 0.9 | 27 | 2142 | same-strand | His Kinase A (phospho-acceptor) domain |
| 15 | PF00672.27 | 0.9 | 27 | 2142.5 | same-strand | HAMP domain |
| 16 | PF12849.9 | 0.7 | 21 | 4067 | same-strand | PBP superfamily domain |
| 17 | PF13531.8 | 0.6 | 18 | 4063.5 | same-strand | Bacterial extracellular solute-binding protein |