Result : P33391
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein DVU_0533 (HMC operon ORF 4) |
| NCBI Accession ID | L16784.1 |
| Organism | Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303) |
| Left | 2383 |
| Right | 2526 |
| Strand | + |
| Nucleotide Sequence | ATGGATCAGGCAATCTACACCCTGCACGAGTTCATGCTCCACACCAAGAACTGGACGTACATCCTGATGGGTGTGACGCTCTTGGTGTACGTGGGTTACTGGCTCTTCCTCACCGGGCGTGACGAGAAGATCCGCAAATACTAG |
| Sequence | MDQAIYTLHEFMLHTKNWTYILMGVTLLVYVGYWLFLTGRDEKIRKY |
| Source of smORF | Swiss-Prot |
| Function | HMWC (high-molecular-weight cytochrome c), ORF2, ORF3, ORF4, ORF5 and ORF6 in the HMC operon form a transmembrane protein complex that allows electron flow from the periplasmic hydrogenase to the cytoplasmic enzymes that catalyze reduction of sulfates. |
| Pubmed ID | 8335628 15077118 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P33391 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 609279 | 609422 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 2 | 668822 | 668965 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 3 | 958079 | 958210 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 4 | 6449550 | 6449681 | - | NZ_CP061799.1 | Desulfonema limicola |
| 5 | 5960642 | 5960785 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 6 | 3810664 | 3810795 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 7 | 3661441 | 3661569 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 8 | 3345739 | 3345861 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 9 | 1393908 | 1394030 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 10 | 1032072 | 1032203 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 11 | 2730684 | 2730818 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017310.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 0.64 | 7 | 3522.5 | same-strand | Response regulator receiver domain |
| 2 | PF13534.8 | 1.0 | 11 | 749 | same-strand | 4Fe-4S dicluster domain |
| 3 | PF02754.18 | 1.0 | 11 | 749 | same-strand | Cysteine-rich domain |
| 4 | PF13183.8 | 1.0 | 11 | 749 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13187.8 | 1.0 | 11 | 1200 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF03916.16 | 1.0 | 11 | 23 | same-strand | Polysulphide reductase, NrfD |
| 7 | PF13247.8 | 1.0 | 11 | 1200 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12838.9 | 0.91 | 10 | 1200 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF13237.8 | 1.0 | 11 | 1200 | same-strand | 4Fe-4S dicluster domain |
| 10 | PF12837.9 | 1.0 | 11 | 1200 | same-strand | 4Fe-4S binding domain |
| 11 | PF00037.29 | 1.0 | 11 | 1200 | same-strand | 4Fe-4S binding domain |
| 12 | PF02085.18 | 1.0 | 11 | 2320 | same-strand | Class III cytochrome C family |
| 13 | PF14522.8 | 0.82 | 9 | 2335 | same-strand | Cytochrome c7 and related cytochrome c |
++ More..