Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YehE |
NCBI Accession ID | U00007.1 |
Organism | Escherichia coli (strain K12) |
Left | 5283 |
Right | 5564 |
Strand | - |
Nucleotide Sequence | ATGAATAAGTATTGGCTGTCAGGAATTATTTTTCTTGCCTATGGATTGGCTTCTCCCGCATTCTCTTCAGAGACTGCCACATTAGCGATTAATGGCAGGATCAGTCCCCCAACATGCAGTATGGCTATGGTTAATGGTCAACCTCAACAGCATTGTGGTCAGTTAACGTATAATGTTGACACCCGTCATCTGTTTTCTTCGCCCGTCAAAGGTGTAACGACAGAAGTGGTTGTTGCAGGTAGCGATAGCAAACGTCGAATCGTGTTAAATCGCTACGATTAA |
Sequence | MNKYWLSGIIFLAYGLASPAFSSETATLAINGRISPPTCSMAMVNGQPQQHCGQLTYNVDTRHLFSSPVKGVTTEVVVAGSDSKRRIVLNRYD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10836. Profile Description: Protein of unknown function (DUF2574). This family of proteins appears to be restricted to Enterobacteriaceae. Members of the family are annotated as yehE however currently no function is known. |
Pubmed ID | 9278503 16738553 |
Domain | CDD:287772 |
Functional Category | Others |
Uniprot ID | P33344 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2192515 | 2192796 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 2199579 | 2199860 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 1606770 | 1607033 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 2736190 | 2736471 | - | NZ_LR134340.1 | Escherichia marmotae |
5 | 2192687 | 2192968 | - | NZ_AP014857.1 | Escherichia albertii |
6 | 2868381 | 2868662 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
7 | 4145233 | 4145514 | + | NZ_CP044098.1 | Citrobacter portucalensis |
8 | 649523 | 649804 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00419.22 | 0.71 | 5 | 294 | same-strand | Fimbrial protein |
2 | PF00577.22 | 0.86 | 6 | 1612 | same-strand | Outer membrane usher protein |
3 | PF13954.8 | 0.71 | 5 | 1608.5 | same-strand | PapC N-terminal domain |
4 | PF13953.8 | 0.86 | 6 | 1612 | same-strand | PapC C-terminal domain |
5 | PF00345.22 | 0.71 | 5 | 918.5 | same-strand | Pili and flagellar-assembly chaperone, PapD N-terminal domain |
6 | PF02753.19 | 0.71 | 5 | 922.0 | same-strand | Pili assembly chaperone PapD, C-terminal domain |
7 | PF10609.11 | 1.0 | 7 | 263.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
8 | PF01656.25 | 1.0 | 7 | 263.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
9 | PF09334.13 | 1.0 | 7 | 1504.0 | opposite-strand | tRNA synthetases class I (M) |
10 | PF01588.22 | 1.0 | 7 | 1504.0 | opposite-strand | Putative tRNA binding domain |
11 | PF19303.1 | 0.86 | 6 | 1504 | opposite-strand | Anticodon binding domain of methionyl tRNA ligase |