Protein Information |
Information Type | Description |
---|---|
Protein name | Regulatory protein MokC |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 16751 |
Right | 16960 |
Strand | - |
Nucleotide Sequence | ATGCTGAACACATGTAGAGTGCCTCTTACTGACCGTAAGGTCAAGGAGAAGAGAGCAATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAAAGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA |
Sequence | MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE |
Source of smORF | Swiss-Prot |
Function | Might be the toxic component of a type I toxin-antitoxin (TA) system (By similarity). Regulatory peptide which completely overlaps hokC and enables hokC expression. {ECO:0000250|UniProtKB:P0ACG4, ECO:0000305|Pubmed:10361310}. |
Pubmed ID | 1943701 9278503 16738553 10361310 |
Domain | CDD:421511 |
Functional Category | Toxin_type_1 |
Uniprot ID | P33236 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 15566 | 15775 | - | NZ_AP014857.1 | Escherichia albertii |
2 | 1334545 | 1334727 | + | NZ_AP014857.1 | Escherichia albertii |
3 | 3546880 | 3547089 | - | NZ_CP057657.1 | Escherichia fergusonii |
4 | 15401 | 15610 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 2063981 | 2064193 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
6 | 1397796 | 1398008 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
7 | 905930 | 906142 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
8 | 16751 | 16960 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
9 | 15419 | 15628 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
10 | 1769393 | 1769605 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
11 | 1551255 | 1551467 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
12 | 2243637 | 2243849 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
13 | 2194047 | 2194259 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
14 | 1305419 | 1305631 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
15 | 1174662 | 1174844 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
16 | 2700908 | 2701120 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
17 | 3599068 | 3599277 | + | NZ_CP061527.1 | Shigella dysenteriae |
18 | 2286168 | 2286380 | - | NZ_CP061527.1 | Shigella dysenteriae |
19 | 2332129 | 2332341 | - | NZ_LR134340.1 | Escherichia marmotae |
20 | 4220702 | 4220911 | + | NZ_CP011104.1 | Photorhabdus thracensis |
21 | 4223116 | 4223325 | + | NZ_CP011104.1 | Photorhabdus thracensis |
22 | 4221334 | 4221540 | + | NZ_CP011104.1 | Photorhabdus thracensis |
23 | 4219446 | 4219652 | + | NZ_CP011104.1 | Photorhabdus thracensis |
24 | 4220073 | 4220279 | + | NZ_CP011104.1 | Photorhabdus thracensis |
25 | 4218714 | 4218920 | + | NZ_CP011104.1 | Photorhabdus thracensis |
26 | 3416258 | 3416464 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01184.21 | 0.62 | 5 | 4908 | same-strand | GPR1/FUN34/yaaH family |
2 | PF00012.22 | 0.62 | 5 | 1323.0 | opposite-strand | Hsp70 protein |
3 | PF01556.20 | 0.62 | 5 | 104.0 | opposite-strand | DnaJ C terminal domain |
4 | PF00226.33 | 0.62 | 5 | 104.0 | opposite-strand | DnaJ domain |
5 | PF00684.21 | 0.62 | 5 | 104.0 | opposite-strand | DnaJ central domain |
6 | PF06965.14 | 0.62 | 5 | 529.5 | opposite-strand | Na+/H+ antiporter 1 |
7 | PF00126.29 | 0.62 | 5 | 1761.5 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
8 | PF03466.22 | 0.62 | 5 | 1761.5 | opposite-strand | LysR substrate binding domain |