Result : P33236
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Regulatory protein MokC |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 16751 |
| Right | 16960 |
| Strand | - |
| Nucleotide Sequence | ATGCTGAACACATGTAGAGTGCCTCTTACTGACCGTAAGGTCAAGGAGAAGAGAGCAATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAAAGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA |
| Sequence | MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE |
| Source of smORF | Swiss-Prot |
| Function | Might be the toxic component of a type I toxin-antitoxin (TA) system (By similarity). Regulatory peptide which completely overlaps hokC and enables hokC expression. {ECO:0000250|UniProtKB:P0ACG4, ECO:0000305|Pubmed:10361310}. |
| Pubmed ID | 1943701 9278503 16738553 10361310 |
| Domain | CDD:421511 |
| Functional Category | Toxin_type_1 |
| Uniprot ID | P33236 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 15566 | 15775 | - | NZ_AP014857.1 | Escherichia albertii |
| 2 | 1334545 | 1334727 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 3546880 | 3547089 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 15401 | 15610 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 2063981 | 2064193 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 1397796 | 1398008 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 905930 | 906142 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 8 | 16751 | 16960 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 9 | 15419 | 15628 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 10 | 1769393 | 1769605 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 11 | 1551255 | 1551467 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 12 | 2243637 | 2243849 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 13 | 2194047 | 2194259 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 14 | 1305419 | 1305631 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 15 | 1174662 | 1174844 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 16 | 2700908 | 2701120 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 17 | 3599068 | 3599277 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 18 | 2286168 | 2286380 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 19 | 2332129 | 2332341 | - | NZ_LR134340.1 | Escherichia marmotae |
| 20 | 4220702 | 4220911 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 21 | 4223116 | 4223325 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 22 | 4221334 | 4221540 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 23 | 4219446 | 4219652 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 24 | 4220073 | 4220279 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 25 | 4218714 | 4218920 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 26 | 3416258 | 3416464 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01184.21 | 0.62 | 5 | 4908 | same-strand | GPR1/FUN34/yaaH family |
| 2 | PF00012.22 | 0.62 | 5 | 1323.0 | opposite-strand | Hsp70 protein |
| 3 | PF01556.20 | 0.62 | 5 | 104.0 | opposite-strand | DnaJ C terminal domain |
| 4 | PF00226.33 | 0.62 | 5 | 104.0 | opposite-strand | DnaJ domain |
| 5 | PF00684.21 | 0.62 | 5 | 104.0 | opposite-strand | DnaJ central domain |
| 6 | PF06965.14 | 0.62 | 5 | 529.5 | opposite-strand | Na+/H+ antiporter 1 |
| 7 | PF00126.29 | 0.62 | 5 | 1761.5 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 8 | PF03466.22 | 0.62 | 5 | 1761.5 | opposite-strand | LysR substrate binding domain |
++ More..