Result : P33230
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Double-strand break reduction protein |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1413531 |
| Right | 1413740 |
| Strand | - |
| Nucleotide Sequence | ATGTATAAAATTACCGCCACTATTGAAAAGGAAGGTGGCACTCCTACTAACTGGACAAGATATTCAAAATCTAAACTAACGAAATCAGAATGCGAAAAAATGCTCTCAGGTAAAAAAGAAGCAGGCGTTTCCAGAGAGCAGAAAGTAAAACTGATAAATTTTAATTGCGAGAAACTTCAGTCCTCGAGAATTGCATTGTATTCAAATTAA |
| Sequence | MYKITATIEKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQSSRIALYSN |
| Source of smORF | Swiss-Prot |
| Function | Helps to maintain the integrity of the chromosome by lowering the steady-state level of double strand breaks (Pubmed:22343303). This region of DNA acts as an antitoxin to toxin RalR, a DNase, but it seems to be sRNA RalA that has the antitoxin activity and not this putative protein. Therefore the identity of this as a protein-coding gene has been cast into doubt (Pubmed:24748661). {ECO:0000269|Pubmed:22343303, ECO:0000269|Pubmed:24748661}. |
| Pubmed ID | 9097039 9278503 16738553 8244937 22343303 24748661 |
| Domain | CDD:305031 |
| Functional Category | Others |
| Uniprot ID | P33230 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2344296 | 2344505 | + | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 1413531 | 1413740 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06630.13 | 1.0 | 2 | 1046.0 | same-strand | Enterobacterial exodeoxyribonuclease VIII |
| 2 | PF12684.9 | 1.0 | 2 | 1046.0 | same-strand | PDDEXK-like domain of unknown function (DUF3799) |
| 3 | PF03837.16 | 1.0 | 2 | 244.0 | same-strand | RecT family |
| 4 | PF06806.14 | 1.0 | 2 | 79.0 | same-strand | Putative excisionase (DUF1233) |
| 5 | PF12167.10 | 1.0 | 2 | 296.0 | same-strand | Arm DNA-binding domain |
| 6 | PF00589.24 | 1.0 | 2 | 296.0 | same-strand | Phage integrase family |
| 7 | PF14659.8 | 1.0 | 2 | 296.0 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 8 | PF01171.22 | 1.0 | 2 | 1583.0 | same-strand | PP-loop family |
| 9 | PF00270.31 | 1.0 | 2 | 2630.0 | opposite-strand | DEAD/DEAH box helicase |
| 10 | PF00271.33 | 1.0 | 2 | 2630.0 | opposite-strand | Helicase conserved C-terminal domain |
| 11 | PF03880.17 | 1.0 | 2 | 2630.0 | opposite-strand | DbpA RNA binding domain |
| 12 | PF04851.17 | 1.0 | 2 | 2630.0 | opposite-strand | Type III restriction enzyme, res subunit |
++ More..