Result : P33104
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | X17524.1 |
| Organism | Micrococcus luteus (Micrococcus lysodeikticus) |
| Left | 3792 |
| Right | 4016 |
| Strand | + |
| Nucleotide Sequence | GTGTTTGAGTCCACTCGCAAGAACATCCAGCCCTCGGACGCCACCCTGGTCATCACCCAGACCCGCGGCGTCACGGGCTCCAAGCAGAACCATCGGGACACCCTGCGCTCGCTGGGCCTGAAGCGGATCGGCCACCAGGTCACCCGCAAGGCCGACGCGGTGACGGTCGGCATGGTCAACACCGTGCCGCACCTGGTGTCCGTGGAGGAGGTCAACAATGGCTGA |
| Sequence | MFESTRKNIQPSDATLVITQTRGVTGSKQNHRDTLRSLGLKRIGHQVTRKADAVTVGMVNTVPHLVSVEEVNNG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 2533272 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P33104 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1849143 | 1849367 | - | NC_012803.1 | Micrococcus luteus NCTC 2665 |
| 2 | 3170430 | 3170636 | - | NZ_CP068013.1 | Paenarthrobacter ureafaciens |
| 3 | 2055980 | 2056192 | - | NZ_CP011005.1 | Psychromicrobium lacuslunae |
| 4 | 2561539 | 2561745 | + | NZ_CP018135.1 | Neomicrococcus aestuarii |
| 5 | 2997763 | 2997975 | - | NZ_CP013745.1 | Arthrobacter alpinus |
| 6 | 1900164 | 1900352 | - | NC_010168.1 | Renibacterium salmoninarum ATCC 33209 |
| 7 | 4267149 | 4267361 | - | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 8 | 315212 | 315430 | - | NZ_CP018863.1 | Arthrobacter crystallopoietes |
| 9 | 2325233 | 2325436 | - | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 10 | 2514425 | 2514643 | - | NZ_LR131272.1 | Arthrobacter agilis |
| 11 | 299761 | 299967 | - | NC_014643.1 | Rothia dentocariosa ATCC 17931 |
| 12 | 1993228 | 1993434 | - | NZ_LR134479.1 | Rothia aeria |
| 13 | 717009 | 717218 | + | NZ_CP061539.1 | Rothia terrae |
| 14 | 678364 | 678573 | + | NZ_CP056080.1 | Rothia nasimurium |
| 15 | 675173 | 675382 | + | NZ_CP061538.1 | Rothia amarae |
| 16 | 2482854 | 2483060 | - | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 17 | 2637082 | 2637288 | - | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 18 | 1270730 | 1270936 | - | NZ_CP042260.1 | Glutamicibacter halophytocola |
| 19 | 3128649 | 3128858 | - | NZ_CP013254.1 | Kocuria flava |
| 20 | 723963 | 724169 | + | NZ_CP035504.1 | Kocuria indica |
| 21 | 2252268 | 2252477 | - | NZ_CP012507.1 | Kocuria palustris |
| 22 | 3881868 | 3882050 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 23 | 7510057 | 7510239 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 24 | 3977582 | 3977767 | - | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 25 | 635359 | 635556 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 26 | 846670 | 846852 | - | NZ_CP038436.1 | Nocardioides seonyuensis |
| 27 | 1448890 | 1449078 | - | NZ_CP041146.1 | Nocardioides humi |
| 28 | 2458500 | 2458685 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 29 | 4303236 | 4303424 | - | NZ_CP009896.1 | Pimelobacter simplex |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012803.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00557.26 | 0.9 | 26 | 2706.0 | same-strand | Metallopeptidase family M24 |
| 2 | PF00406.24 | 0.97 | 28 | 2010.0 | same-strand | Adenylate kinase |
| 3 | PF13207.8 | 0.97 | 28 | 2010.0 | same-strand | AAA domain |
| 4 | PF13671.8 | 0.93 | 27 | 2010 | same-strand | AAA domain |
| 5 | PF13238.8 | 0.93 | 27 | 2010 | same-strand | AAA domain |
| 6 | PF00344.22 | 1.0 | 29 | 700 | same-strand | SecY |
| 7 | PF00828.21 | 1.0 | 29 | 3 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00333.22 | 1.0 | 29 | 0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 9 | PF03719.17 | 1.0 | 29 | 0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 10 | PF00861.24 | 1.0 | 29 | 700 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 11 | PF00347.25 | 1.0 | 29 | 1084 | same-strand | Ribosomal protein L6 |
| 12 | PF00410.21 | 1.0 | 29 | 1642 | same-strand | Ribosomal protein S8 |
| 13 | PF00673.23 | 0.72 | 21 | 2123 | same-strand | ribosomal L5P family C-terminus |
| 14 | PF00281.21 | 0.72 | 21 | 2123 | same-strand | Ribosomal protein L5 |
++ More..