Result : P32730
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlxP (ORF5) |
| NCBI Accession ID | Z18631.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4836 |
| Right | 5114 |
| Strand | + |
| Nucleotide Sequence | GTGATCGGATTTGCGGAGTGTGAATGCATCATTTATGATGCAGGATCGCTAAAAGAAAAGCGTGCCGTTCTGAAGCGGATTTTAACCAGGGTTCAAAACAAGTTCAATGTTTCGATTTCGGAGATTGGCTATCAGGACACCTGGCAAAGAACCAGCTTCGGAATCGCCGCTGTTTCTTCCTCTCGCGTTCAAACAGAAAAAGAACTGCAGCGCGTCCTAGCGTTTATCGATTCTTTTCCTGAAATTGAACGGACGATCACTAGGACAGAGTGGTTTTAA |
| Sequence | MIGFAECECIIYDAGSLKEKRAVLKRILTRVQNKFNVSISEIGYQDTWQRTSFGIAAVSSSRVQTEKELQRVLAFIDSFPEIERTITRTEWF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00669. Profile Description: Protein of unknown function (DUF503). Family of hypothetical bacterial proteins. |
| Pubmed ID | 8491709 9384377 |
| Domain | CDD:412509 |
| Functional Category | Others |
| Uniprot ID | P32730 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 72
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1740296 | 1740574 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 2 | 1703945 | 1704223 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 249701 | 249979 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 1736156 | 1736434 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 1643807 | 1644085 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1914495 | 1914773 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1709009 | 1709287 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 2270082 | 2270360 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1690767 | 1691045 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1849121 | 1849399 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1871772 | 1872050 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1870881 | 1871159 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3664066 | 3664344 | - | NZ_CP043404.1 | Bacillus safensis |
| 14 | 1644254 | 1644532 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 55951 | 56229 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 2726548 | 2726826 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 17 | 681932 | 682210 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 1865496 | 1865774 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 19 | 1494270 | 1494548 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 20 | 4897304 | 4897534 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 21 | 2303153 | 2303431 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 22 | 3926877 | 3927155 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 23 | 1101714 | 1101992 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 24 | 1174265 | 1174546 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 25 | 3334652 | 3334930 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 26 | 2135366 | 2135647 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 27 | 1280625 | 1280903 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 28 | 728466 | 728744 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 29 | 366483 | 366761 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 30 | 2702171 | 2702449 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 31 | 2089592 | 2089870 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 32 | 2237752 | 2238012 | + | NZ_CP053989.1 | Niallia circulans |
| 33 | 3829237 | 3829476 | - | NC_011725.1 | Bacillus cereus B4264 |
| 34 | 1535061 | 1535300 | + | NZ_CP040336.1 | Bacillus luti |
| 35 | 3624651 | 3624890 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 36 | 3694189 | 3694428 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 37 | 3833483 | 3833722 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 38 | 82073 | 82324 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 39 | 4300594 | 4300824 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 40 | 2383502 | 2383780 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 41 | 2552373 | 2552612 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 42 | 2074864 | 2075142 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 43 | 892666 | 892896 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 44 | 3473607 | 3473885 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 45 | 2505051 | 2505329 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 46 | 1618189 | 1618467 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 47 | 1756076 | 1756354 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 48 | 1736723 | 1737001 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 49 | 205786 | 206064 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 50 | 1833168 | 1833419 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 51 | 1338396 | 1338674 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 52 | 2605709 | 2605987 | - | NZ_LS483476.1 | Lederbergia lentus |
| 53 | 2504041 | 2504319 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 54 | 1854434 | 1854712 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 55 | 2533809 | 2534075 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 56 | 1535484 | 1535762 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 57 | 2032954 | 2033232 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 58 | 1265249 | 1265527 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 59 | 1382388 | 1382666 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 60 | 1419134 | 1419415 | + | NZ_CP012024.1 | Bacillus smithii |
| 61 | 2276692 | 2276931 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 62 | 2010451 | 2010729 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 63 | 1803935 | 1804213 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 64 | 1334562 | 1334840 | + | NZ_LT906444.1 | Listeria welshimeri |
| 65 | 1356032 | 1356310 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 66 | 1500403 | 1500684 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 67 | 1387149 | 1387400 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 68 | 1271235 | 1271513 | + | NZ_LR134483.1 | Listeria grayi |
| 69 | 3673665 | 3673943 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 70 | 3210540 | 3210818 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 71 | 1121009 | 1121287 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 72 | 3551904 | 3552182 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02576.19 | 0.97 | 70 | 3965.5 | same-strand | RimP N-terminal domain |
| 2 | PF17384.4 | 0.97 | 70 | 3965.5 | same-strand | RimP C-terminal SH3 domain |
| 3 | PF08529.13 | 0.99 | 71 | 2786 | same-strand | NusA N-terminal domain |
| 4 | PF13184.8 | 0.99 | 71 | 2786 | same-strand | NusA-like KH domain |
| 5 | PF00575.25 | 1.0 | 72 | 2895.5 | same-strand | S1 RNA binding domain |
| 6 | PF04296.15 | 1.0 | 72 | 2490.0 | same-strand | Protein of unknown function (DUF448) |
| 7 | PF01248.28 | 1.0 | 72 | 2188.0 | same-strand | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
| 8 | PF11987.10 | 1.0 | 72 | -3.0 | same-strand | Translation-initiation factor 2 |
| 9 | PF00009.29 | 1.0 | 72 | -3.0 | same-strand | Elongation factor Tu GTP binding domain |
| 10 | PF04760.17 | 1.0 | 72 | -3.0 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 11 | PF01926.25 | 1.0 | 72 | -3.0 | same-strand | 50S ribosome-binding GTPase |
| 12 | PF00025.23 | 1.0 | 72 | -3.0 | same-strand | ADP-ribosylation factor family |
| 13 | PF00071.24 | 0.69 | 50 | -3.0 | same-strand | Ras family |
| 14 | PF02421.20 | 0.89 | 64 | -3.0 | same-strand | Ferrous iron transport protein B |
| 15 | PF02033.20 | 1.0 | 72 | 17.0 | same-strand | Ribosome-binding factor A |
| 16 | PF01509.20 | 1.0 | 72 | 457.0 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 17 | PF16198.7 | 0.99 | 71 | 457 | same-strand | tRNA pseudouridylate synthase B C-terminal domain |
| 18 | PF06574.14 | 1.0 | 72 | 1412.5 | same-strand | FAD synthetase |
| 19 | PF01687.19 | 0.97 | 70 | 1415.5 | same-strand | Riboflavin kinase |
| 20 | PF00312.24 | 1.0 | 72 | 2508.5 | same-strand | Ribosomal protein S15 |
| 21 | PF01138.23 | 0.96 | 69 | 2954 | same-strand | 3' exoribonuclease family, domain 1 |
| 22 | PF03725.17 | 0.96 | 69 | 2954 | same-strand | 3' exoribonuclease family, domain 2 |
| 23 | PF03726.16 | 0.96 | 69 | 2954 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
| 24 | PF00013.31 | 0.96 | 69 | 2954 | same-strand | KH domain |
++ More..