Result : P32729
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable ribosomal protein YlxQ |
| NCBI Accession ID | Z18631.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2367 |
| Right | 2669 |
| Strand | + |
| Nucleotide Sequence | ATGTCTGGAATGGAATGGTTTCCCTTGCTGGGTCTGGCCAATCGAGCTCGTAAGGTCGTGTCAGGCGAAGACTTGGTAATAAAAGAAATCAGGAATGCGCGTGCAAAGCTTGTCCTGCTTACAGAGGATGCATCATCTAACACAGCAAAAAAAGTAACTGACAAGTGCAATTATTATAAAGTCCCTTATAAAAAAGTCGAGAGTCGCGCGGTTCTTGGACGCTCTATCGGTAAAGAAGCCCGTGTCGTTGTCGCCGTCACTGACCAAGGTTTTGCGAATAAGCTGATCAGCTTGCTCGATTAA |
| Sequence | MSGMEWFPLLGLANRARKVVSGEDLVIKEIRNARAKLVLLTEDASSNTAKKVTDKCNYYKVPYKKVESRAVLGRSIGKEARVVVAVTDQGFANKLISLLD |
| Source of smORF | Swiss-Prot |
| Function | RNA-binding protein that recognizes the K-turn motif present in ribosomal RNA, but also in box C/D and box C'/D' sRNAs. {ECO:0000269|Pubmed:22355167}. |
| Pubmed ID | 8491709 9384377 22355167 |
| Domain | CDD:412466 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P32729 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 146
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1912026 | 1912328 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 1701479 | 1701781 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1706537 | 1706839 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1733687 | 1733989 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 1641338 | 1641640 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1737827 | 1738129 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2272527 | 2272829 | - | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 1688304 | 1688606 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 252146 | 252448 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 58366 | 58668 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 1641815 | 1642117 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 3666481 | 3666783 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1846651 | 1846953 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1869297 | 1869599 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 1868394 | 1868696 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 4899827 | 4900129 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 17 | 1830570 | 1830872 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 18 | 2608285 | 2608590 | - | NZ_LS483476.1 | Lederbergia lentus |
| 19 | 2132813 | 2133115 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 20 | 1862952 | 1863254 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 21 | 2305640 | 2305942 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 22 | 679427 | 679744 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 23 | 4298101 | 4298370 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 24 | 2235238 | 2235540 | + | NZ_CP053989.1 | Niallia circulans |
| 25 | 1607103 | 1607411 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 26 | 2729041 | 2729343 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 1176738 | 1177040 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 28 | 895120 | 895389 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 29 | 84500 | 84802 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 30 | 3835826 | 3836137 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 31 | 1532646 | 1532957 | + | NZ_CP040336.1 | Bacillus luti |
| 32 | 3626994 | 3627305 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 33 | 3831580 | 3831891 | - | NC_011725.1 | Bacillus cereus B4264 |
| 34 | 2554725 | 2555021 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 35 | 3696532 | 3696843 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 36 | 1416659 | 1416904 | + | NZ_CP012024.1 | Bacillus smithii |
| 37 | 2507538 | 2507840 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 38 | 2092100 | 2092402 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 39 | 2506521 | 2506829 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 40 | 3337106 | 3337405 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 41 | 3929043 | 3929291 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 42 | 1278089 | 1278397 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 43 | 363945 | 364247 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 44 | 2704679 | 2704987 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 45 | 725928 | 726236 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 46 | 202896 | 203204 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 47 | 1099216 | 1099515 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 48 | 1118401 | 1118709 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 49 | 3554482 | 3554790 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 50 | 1491789 | 1492082 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 51 | 3676237 | 3676545 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 52 | 1734077 | 1734394 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 53 | 1800977 | 1801231 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 54 | 1721562 | 1721867 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 55 | 1940218 | 1940526 | - | NZ_CP016538.2 | Planococcus maritimus |
| 56 | 1963811 | 1964119 | - | NZ_CP059540.1 | Planococcus maritimus |
| 57 | 1695019 | 1695327 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 58 | 1917644 | 1917952 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 59 | 2658430 | 2658732 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 60 | 1315088 | 1315354 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 61 | 1817942 | 1818223 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 62 | 6308197 | 6308439 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 63 | 3471124 | 3471423 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 64 | 2279092 | 2279403 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 65 | 2013367 | 2013630 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 66 | 1532658 | 1532978 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 67 | 1832594 | 1832860 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 68 | 3091782 | 3092093 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 69 | 2169039 | 2169383 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 70 | 1268642 | 1268941 | + | NZ_LR134483.1 | Listeria grayi |
| 71 | 898854 | 899165 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 72 | 3049841 | 3050185 | + | NZ_CP013661.2 | Planococcus kocurii |
| 73 | 2213629 | 2213973 | - | NZ_CP019401.1 | Planococcus faecalis |
| 74 | 2353205 | 2353549 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 75 | 2066123 | 2066467 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 76 | 2079435 | 2079779 | - | NZ_CP016540.2 | Planococcus versutus |
| 77 | 1310684 | 1310977 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 78 | 365507 | 365794 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 79 | 1353374 | 1353673 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 80 | 1753793 | 1754056 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 81 | 1331925 | 1332200 | + | NZ_LT906444.1 | Listeria welshimeri |
| 82 | 1477302 | 1477565 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 83 | 1262588 | 1262887 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 84 | 909741 | 909992 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 85 | 1629031 | 1629348 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 86 | 1651124 | 1651390 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 87 | 1379727 | 1380026 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 88 | 1486610 | 1486900 | - | NZ_CP034118.1 | Staphylospora marina |
| 89 | 1635774 | 1636076 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 90 | 2385848 | 2386162 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 91 | 1502777 | 1503082 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 92 | 2483228 | 2483491 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 93 | 1615801 | 1616061 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 94 | 935399 | 935671 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 95 | 1549149 | 1549391 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 96 | 57015 | 57332 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 97 | 2677861 | 2678106 | + | NZ_CP026363.1 | Brevibacillus agri |
| 98 | 4703656 | 4703958 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 99 | 1852022 | 1852267 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 100 | 1266735 | 1267052 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 101 | 1196090 | 1196407 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 102 | 128750 | 129016 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 103 | 3705927 | 3706181 | - | NZ_CP009288.1 | Paenibacillus durus |
| 104 | 3187947 | 3188201 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 105 | 1456720 | 1456989 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 106 | 2884308 | 2884562 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 107 | 1727282 | 1727602 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 108 | 3375376 | 3375630 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 109 | 2677847 | 2678155 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 110 | 6229044 | 6229319 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 111 | 2527885 | 2528154 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 112 | 3845018 | 3845320 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 113 | 4247328 | 4247579 | - | NZ_AP019400.1 | Cohnella abietis |
| 114 | 4439989 | 4440291 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 115 | 3909728 | 3910030 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 116 | 5564324 | 5564578 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 117 | 3996113 | 3996364 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 118 | 1120659 | 1120913 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 119 | 1125007 | 1125261 | + | NZ_CP033433.1 | Cohnella candidum |
| 120 | 3422020 | 3422322 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 121 | 3068878 | 3069153 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 122 | 1969307 | 1969585 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 123 | 1256928 | 1257233 | - | NZ_CP039712.1 | Vagococcus zengguangii |
| 124 | 296876 | 297175 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 125 | 3654775 | 3655050 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 126 | 340125 | 340424 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 127 | 3658108 | 3658350 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 128 | 6094862 | 6095116 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 129 | 6234390 | 6234644 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 130 | 4162174 | 4162428 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 131 | 4882950 | 4883192 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 132 | 4105279 | 4105569 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 133 | 336425 | 336700 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 134 | 4651839 | 4652081 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 135 | 4693908 | 4694162 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 136 | 459026 | 459301 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 137 | 1860829 | 1861131 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 138 | 3916919 | 3917161 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 139 | 4724128 | 4724385 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 140 | 1748330 | 1748596 | - | NC_012924.1 | Streptococcus suis SC84 |
| 141 | 2095007 | 2095264 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 142 | 1589700 | 1589975 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 143 | 1808996 | 1809238 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 144 | 987290 | 987562 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 145 | 1746389 | 1746652 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 146 | 1153127 | 1153429 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 147 | 1024896 | 1025159 | + | NZ_CP023074.1 | Enterococcus thailandicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00587.27 | 0.72 | 105 | 6662.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 2 | PF03129.22 | 0.72 | 105 | 6662.0 | same-strand | Anticodon binding domain |
| 3 | PF02811.21 | 0.83 | 121 | 2198.5 | same-strand | PHP domain |
| 4 | PF00929.26 | 0.83 | 121 | 2198.5 | same-strand | Exonuclease |
| 5 | PF11490.10 | 0.82 | 120 | 2199 | same-strand | DNA polymerase III polC-type N-terminus II |
| 6 | PF17657.3 | 0.84 | 122 | 2199 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 7 | PF14480.8 | 0.83 | 121 | 2198.5 | same-strand | DNA polymerase III polC-type N-terminus I |
| 8 | PF14579.8 | 0.83 | 121 | 2201.0 | same-strand | Helix-hairpin-helix motif |
| 9 | PF02576.19 | 0.99 | 144 | 1489 | same-strand | RimP N-terminal domain |
| 10 | PF17384.4 | 1.0 | 146 | 1490 | same-strand | RimP C-terminal SH3 domain |
| 11 | PF08529.13 | 1.0 | 146 | 305 | same-strand | NusA N-terminal domain |
| 12 | PF13184.8 | 0.99 | 145 | 304.5 | same-strand | NusA-like KH domain |
| 13 | PF00575.25 | 0.94 | 137 | 302.5 | same-strand | S1 RNA binding domain |
| 14 | PF04296.15 | 1.0 | 146 | 2 | same-strand | Protein of unknown function (DUF448) |
| 15 | PF11987.10 | 1.0 | 146 | 15 | same-strand | Translation-initiation factor 2 |
| 16 | PF00009.29 | 1.0 | 146 | 15 | same-strand | Elongation factor Tu GTP binding domain |
| 17 | PF04760.17 | 1.0 | 146 | 15 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 18 | PF01926.25 | 1.0 | 146 | 15 | same-strand | 50S ribosome-binding GTPase |
| 19 | PF00025.23 | 0.88 | 128 | 15 | same-strand | ADP-ribosylation factor family |
| 20 | PF00071.24 | 0.79 | 116 | 15 | same-strand | Ras family |
| 21 | PF02421.20 | 0.83 | 121 | 15.0 | same-strand | Ferrous iron transport protein B |
| 22 | PF04456.14 | 0.62 | 90 | 2212 | same-strand | Protein of unknown function (DUF503) |
| 23 | PF02033.20 | 1.0 | 146 | 2561 | same-strand | Ribosome-binding factor A |
| 24 | PF01509.20 | 0.94 | 137 | 3035.5 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 25 | PF16198.7 | 0.91 | 133 | 3029.5 | same-strand | tRNA pseudouridylate synthase B C-terminal domain |
| 26 | PF06574.14 | 0.87 | 127 | 3959.5 | same-strand | FAD synthetase |
| 27 | PF01687.19 | 0.87 | 127 | 3959.5 | same-strand | Riboflavin kinase |
++ More..