Result : P32728
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlxR (ORF3) |
| NCBI Accession ID | Z18631.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2090 |
| Right | 2365 |
| Strand | + |
| Nucleotide Sequence | GTGAATAAACACAAAAAGATCCCATTACGCAAATGTGTAGTGACTGGTGAAATGAAGCCTAAAAAGGAACTGATCCGAGTTGTACGGTCGAAAGAAGGCGAAATCTCAGTAGACCCGACCGGAAAAAAGAATGGGCGGGGTGCTTATTTAACGCTGGATAAAGAGTGCATCTTAGCAGCAAAAAAGAAAAACACTTTGCAAAATCAATTTCAATCACAAATCGATGACCAGATTTTCGATGAATTGCTGGAACTGGCGGAAAAGGTGAAAAAATAA |
| Sequence | MNKHKKIPLRKCVVTGEMKPKKELIRVVRSKEGEISVDPTGKKNGRGAYLTLDKECILAAKKKNTLQNQFQSQIDDQIFDELLELAEKVKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00189. Profile Description: N/A. Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation |
| Pubmed ID | 8491709 9384377 |
| Domain | CDD:412207 |
| Functional Category | Others |
| Uniprot ID | P32728 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 218
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1733410 | 1733685 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1737550 | 1737825 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 1706260 | 1706535 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 252450 | 252725 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1641061 | 1641336 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1701202 | 1701477 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 1911749 | 1912024 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 2272831 | 2273106 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1688027 | 1688302 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1869071 | 1869292 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 1868169 | 1868393 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 1846426 | 1846650 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 1641589 | 1641822 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 3666776 | 3667009 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 58661 | 58894 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 1277809 | 1278099 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 17 | 363665 | 363955 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 18 | 2704977 | 2705267 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 19 | 725648 | 725938 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 20 | 1098987 | 1099226 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 2729333 | 2729623 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 22 | 1491539 | 1491778 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 23 | 1177046 | 1177321 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 24 | 2305939 | 2306172 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 25 | 2092392 | 2092682 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 26 | 4297785 | 4298060 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 27 | 895430 | 895705 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 28 | 1862672 | 1862962 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 29 | 679147 | 679437 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 30 | 2234957 | 2235241 | + | NZ_CP053989.1 | Niallia circulans |
| 31 | 1733796 | 1734080 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 32 | 4900135 | 4900410 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 33 | 3337402 | 3337686 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 34 | 2506834 | 2507109 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 35 | 3929342 | 3929623 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 36 | 1416311 | 1416586 | + | NZ_CP012024.1 | Bacillus smithii |
| 37 | 84812 | 85084 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 38 | 2507837 | 2508118 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 39 | 1830289 | 1830570 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 40 | 202606 | 202899 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 41 | 2608594 | 2608869 | - | NZ_LS483476.1 | Lederbergia lentus |
| 42 | 1606831 | 1607106 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 43 | 1335700 | 1335924 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 44 | 2132532 | 2132816 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 45 | 2013684 | 2013962 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 46 | 1635554 | 1635784 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 47 | 2035659 | 2035940 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 48 | 2353549 | 2353776 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 49 | 2028007 | 2028258 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 50 | 2066467 | 2066694 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 51 | 2169383 | 2169610 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 52 | 2079779 | 2080006 | - | NZ_CP016540.2 | Planococcus versutus |
| 53 | 3049614 | 3049841 | + | NZ_CP013661.2 | Planococcus kocurii |
| 54 | 2213973 | 2214200 | - | NZ_CP019401.1 | Planococcus faecalis |
| 55 | 2536597 | 2536824 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 56 | 1532383 | 1532661 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 57 | 1615473 | 1615751 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 58 | 401777 | 402055 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 59 | 1851694 | 1851975 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 60 | 1808749 | 1809000 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 61 | 2386159 | 2386434 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 62 | 1925138 | 1925416 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 63 | 3676542 | 3676820 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 64 | 1369681 | 1369929 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 65 | 3384543 | 3384767 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 66 | 742615 | 742866 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 67 | 2478551 | 2478829 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 68 | 1886198 | 1886437 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 69 | 3470849 | 3471124 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 70 | 1727599 | 1727877 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 71 | 1195889 | 1196137 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 72 | 591704 | 591928 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 73 | 1801272 | 1801496 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 74 | 2513341 | 2513622 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 75 | 2279404 | 2279628 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 76 | 2645499 | 2645747 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 77 | 725667 | 725921 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 78 | 774726 | 774977 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 79 | 811888 | 812193 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 80 | 1695324 | 1695554 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 81 | 1816539 | 1816787 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 82 | 1917949 | 1918179 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 83 | 1178481 | 1178717 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 84 | 1046934 | 1047185 | + | NZ_CP027563.1 | Weissella confusa |
| 85 | 2572078 | 2572332 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 86 | 3238734 | 3239015 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 87 | 1291635 | 1291883 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 88 | 1389796 | 1390017 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 89 | 1410635 | 1410886 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 90 | 1709597 | 1709851 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 91 | 581882 | 582106 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 92 | 1210524 | 1210775 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 93 | 3213668 | 3213946 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 94 | 1157462 | 1157719 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 95 | 1026289 | 1026534 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 96 | 1090040 | 1090285 | + | NZ_CP065211.1 | Enterococcus lactis |
| 97 | 371561 | 371857 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 98 | 976425 | 976676 | + | NZ_CP014164.1 | Aerococcus viridans |
| 99 | 1157939 | 1158235 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 100 | 384864 | 385160 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 101 | 1138794 | 1139033 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 102 | 354051 | 354347 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 103 | 1861969 | 1862217 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 104 | 1083872 | 1084117 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 105 | 1144096 | 1144335 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 106 | 1704653 | 1704898 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 107 | 2072191 | 2072466 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 108 | 1750902 | 1751147 | + | NZ_CP023011.2 | Enterococcus hirae |
| 109 | 360233 | 360481 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 110 | 951354 | 951602 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 111 | 983346 | 983597 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 112 | 1257230 | 1257475 | - | NZ_CP039712.1 | Vagococcus zengguangii |
| 113 | 2002931 | 2003227 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 114 | 2095314 | 2095562 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 115 | 890568 | 890813 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 116 | 336109 | 336405 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 117 | 1389832 | 1390080 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 118 | 1470494 | 1470715 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 119 | 750979 | 751230 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 120 | 3845310 | 3845591 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 121 | 1456448 | 1456684 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 122 | 1107655 | 1107915 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 123 | 1964116 | 1964346 | - | NZ_CP059540.1 | Planococcus maritimus |
| 124 | 1940523 | 1940753 | - | NZ_CP016538.2 | Planococcus maritimus |
| 125 | 1024606 | 1024851 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 126 | 1469873 | 1470130 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 127 | 986974 | 987270 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 128 | 3647884 | 3648105 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 129 | 1411836 | 1412057 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 130 | 330240 | 330488 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 131 | 2839602 | 2839832 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 132 | 425543 | 425791 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 133 | 900895 | 901143 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 134 | 2084823 | 2085074 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 135 | 607336 | 607587 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 136 | 1591322 | 1591618 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 137 | 1834258 | 1834506 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 138 | 227024 | 227311 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 139 | 473740 | 474003 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 140 | 1662820 | 1663044 | - | NZ_CP014204.2 | Clostridium baratii |
| 141 | 663210 | 663437 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 142 | 1118126 | 1118404 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 143 | 3554787 | 3555065 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 144 | 67842 | 68114 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 145 | 2708207 | 2708458 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 146 | 1090191 | 1090442 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 147 | 682360 | 682629 | + | NC_022549.1 | Acholeplasma brassicae |
| 148 | 1463166 | 1463435 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 149 | 1173941 | 1174207 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 150 | 1549442 | 1549663 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 151 | 1721320 | 1721565 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 152 | 1249691 | 1249939 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 153 | 574517 | 574750 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 154 | 980332 | 980580 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 155 | 1156857 | 1157096 | + | NZ_CP046314.1 | Gemella morbillorum |
| 156 | 527927 | 528184 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 157 | 1059112 | 1059366 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 158 | 708516 | 708752 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 159 | 1143139 | 1143396 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 160 | 2318366 | 2318590 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 161 | 578049 | 578297 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 162 | 1049620 | 1049859 | - | NZ_LR134484.1 | Gemella haemolysans |
| 163 | 2498183 | 2498407 | - | NZ_CP028842.1 | Clostridium botulinum |
| 164 | 1486911 | 1487141 | - | NZ_CP034118.1 | Staphylospora marina |
| 165 | 320269 | 320538 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 166 | 2994881 | 2995102 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 167 | 1314832 | 1315062 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 168 | 1640430 | 1640699 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 169 | 1697559 | 1697798 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 170 | 2760849 | 2761073 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 171 | 2820007 | 2820234 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 172 | 878360 | 878629 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 173 | 862171 | 862440 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 174 | 2179601 | 2179825 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 175 | 171112 | 171333 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 176 | 143478 | 143708 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 177 | 3085439 | 3085660 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 178 | 1485320 | 1485601 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 179 | 1476971 | 1477258 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 180 | 4819407 | 4819637 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 181 | 1341593 | 1341841 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 182 | 2335000 | 2335227 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 183 | 2607676 | 2607903 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 184 | 1568976 | 1569197 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 185 | 3027317 | 3027538 | - | NZ_CP014176.1 | Clostridium argentinense |
| 186 | 1227062 | 1227286 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 187 | 2008754 | 2008990 | + | NZ_CP036259.1 | Sporomusa termitida |
| 188 | 1631918 | 1632139 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 189 | 3913345 | 3913566 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 190 | 3656785 | 3657009 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 191 | 3081992 | 3082216 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 192 | 2617026 | 2617259 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 193 | 911185 | 911427 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 194 | 603553 | 603792 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 195 | 1146255 | 1146479 | - | NZ_CP016786.1 | Clostridium isatidis |
| 196 | 1306233 | 1306457 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 197 | 2069054 | 2069278 | - | NZ_CP009687.1 | Clostridium aceticum |
| 198 | 3058134 | 3058355 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 199 | 1951388 | 1951612 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 200 | 1209776 | 1209997 | + | NZ_CP020953.1 | Clostridium drakei |
| 201 | 1860950 | 1861171 | - | NZ_HG917868.1 | Clostridium bornimense |
| 202 | 1778212 | 1778433 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 203 | 1456299 | 1456529 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 204 | 522640 | 522864 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 205 | 1469934 | 1470158 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 206 | 1420202 | 1420426 | + | NZ_CP043998.1 | Clostridium diolis |
| 207 | 957069 | 957296 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 208 | 1612082 | 1612306 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 209 | 1341946 | 1342182 | - | NC_008593.1 | Clostridium novyi NT |
| 210 | 1866516 | 1866737 | + | NZ_CP040924.1 | Clostridium thermarum |
| 211 | 162121 | 162345 | - | NZ_CP023671.1 | Clostridium septicum |
| 212 | 1390843 | 1391070 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 213 | 3802231 | 3802503 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 214 | 1215923 | 1216144 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 215 | 1188866 | 1189090 | + | NZ_CP030775.1 | Clostridium butyricum |
| 216 | 2162622 | 2162843 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 217 | 2871160 | 2871384 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 218 | 1185777 | 1186016 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 219 | 246753 | 246974 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02811.21 | 0.66 | 143 | 1919.5 | same-strand | PHP domain |
| 2 | PF00929.26 | 0.64 | 140 | 1917 | same-strand | Exonuclease |
| 3 | PF11490.10 | 0.62 | 135 | 1915.0 | same-strand | DNA polymerase III polC-type N-terminus II |
| 4 | PF17657.3 | 0.66 | 144 | 1922 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 5 | PF14579.8 | 0.64 | 140 | 1917 | same-strand | Helix-hairpin-helix motif |
| 6 | PF02576.19 | 0.99 | 215 | 1220.5 | same-strand | RimP N-terminal domain |
| 7 | PF17384.4 | 0.95 | 208 | 1221 | same-strand | RimP C-terminal SH3 domain |
| 8 | PF08529.13 | 1.0 | 217 | 59.5 | same-strand | NusA N-terminal domain |
| 9 | PF13184.8 | 0.99 | 216 | 59 | same-strand | NusA-like KH domain |
| 10 | PF00575.25 | 0.84 | 183 | 58.5 | same-strand | S1 RNA binding domain |
| 11 | PF01248.28 | 0.93 | 203 | -7.0 | same-strand | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
| 12 | PF11987.10 | 1.0 | 218 | 319 | same-strand | Translation-initiation factor 2 |
| 13 | PF00009.29 | 0.98 | 214 | 319.0 | same-strand | Elongation factor Tu GTP binding domain |
| 14 | PF04760.17 | 1.0 | 218 | 319 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 15 | PF01926.25 | 1.0 | 218 | 319.0 | same-strand | 50S ribosome-binding GTPase |
| 16 | PF00025.23 | 0.81 | 177 | 319.0 | same-strand | ADP-ribosylation factor family |
| 17 | PF00071.24 | 0.82 | 178 | 319 | same-strand | Ras family |
| 18 | PF02421.20 | 0.69 | 150 | 320 | same-strand | Ferrous iron transport protein B |
| 19 | PF02033.20 | 0.98 | 213 | 2783.5 | same-strand | Ribosome-binding factor A |
| 20 | PF01509.20 | 0.81 | 176 | 3419 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 21 | PF16198.7 | 0.75 | 164 | 3408 | same-strand | tRNA pseudouridylate synthase B C-terminal domain |
++ More..