Result : P32693
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjbL |
| NCBI Accession ID | U00006.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 125565 |
| Right | 125819 |
| Strand | + |
| Nucleotide Sequence | ATGTTGAAGATAATACCCGGTGCAACTGGATACTTTAATAAAACACTCAATTCAAATCAATTCGATAATGAAGATGCAATCAAAGATAAATTAGATAATAGAGGTTCAATCAAAGGTAAATTAAATAATATATATGGTAAATCTATTGATTATGCAGCGCTGCGTCATCGGGATATTATTATTGCAAAAATAGATTTGTTTATTCAACGAATCACGCATAATTTATGGCATGCACGTAAAAAAATGTGTTTTTAA |
| Sequence | MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8265357 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P32693 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4260321 | 4260575 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4329206 | 4329460 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3749019 | 3749309 | + | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01219.21 | 1.0 | 3 | 3316 | same-strand | Prokaryotic diacylglycerol kinase |
| 2 | PF00717.25 | 1.0 | 3 | 2598 | same-strand | Peptidase S24-like |
| 3 | PF01726.18 | 1.0 | 3 | 2598 | same-strand | LexA DNA binding domain |
| 4 | PF01554.20 | 1.0 | 3 | 1200 | same-strand | MatE |
| 5 | PF05532.14 | 1.0 | 3 | 875 | same-strand | CsbD-like |
| 6 | PF01475.21 | 1.0 | 3 | 318 | opposite-strand | Ferric uptake regulator family |
| 7 | PF10897.10 | 0.67 | 2 | 24.0 | same-strand | Protein of unknown function (DUF2713) |
| 8 | PF01207.19 | 1.0 | 3 | 1094 | same-strand | Dihydrouridine synthase (Dus) |
| 9 | PF09583.12 | 1.0 | 3 | 2265 | same-strand | Phage shock protein G (Phageshock PspG) |
| 10 | PF00107.28 | 1.0 | 3 | 2673 | opposite-strand | Zinc-binding dehydrogenase |
| 11 | PF13602.8 | 1.0 | 3 | 2673 | opposite-strand | Zinc-binding dehydrogenase |
| 12 | PF03796.17 | 0.67 | 2 | 3739.0 | same-strand | DnaB-like helicase C terminal domain |
| 13 | PF00772.23 | 0.67 | 2 | 3739.0 | same-strand | DnaB-like helicase N terminal domain |
| 14 | PF13481.8 | 0.67 | 2 | 3739.0 | same-strand | AAA domain |
++ More..