ProsmORF-pred
Result : P32162
Protein Information
Information Type Description
Protein name UPF0381 protein YiiS
NCBI Accession ID L19201.1
Organism Escherichia coli (strain K12)
Left 74600
Right 74899
Strand +
Nucleotide Sequence ATGAAAGATGTCGTAGATAAATGCAGTACTAAAGGATGTGCGATTGATATCGGTACGGTGATTGATAACGACAACTGTACCAGTAAGTTTTCGCGCTTTTTTGCCACCCGCGAAGAAGCAGAGTCTTTTATGACCAAACTGAAAGAGCTTGCCGCCGCTACATCCTCTGCAGATGAAGGGGCCAGCGTGGCCTATAAGATTAAGGATCTGGAGGGGCAAGTTGAGCTTGATGCGGCCTTCACTTTCTCATGCCAGGCCGAGATGATTATTTTTGAGTTATCACTGCGTTCGTTAGCTTGA
Sequence MKDVVDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAATSSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLRSLA
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl11449. Profile Description: Protein of unknown function (DUF406). These small proteins are approximately 100 amino acids in length and appear to be found only in gamma proteobacteria. The function of this protein family is unknown. [Hypothetical proteins, Conserved]
Pubmed ID 8346018 9278503 16738553
Domain CDD:416274
Functional Category Others
Uniprot ID P32162
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 15
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4112967 4113266 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 4127949 4128248 + NC_004337.2 Shigella flexneri 2a str. 301
3 4913053 4913352 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 33444 33767 + NZ_CP061527.1 Shigella dysenteriae
5 4081060 4081359 + NZ_AP014857.1 Escherichia albertii
6 139099 139398 + NZ_LR134340.1 Escherichia marmotae
7 3050666 3050965 + NZ_CP057657.1 Escherichia fergusonii
8 2410929 2411222 + NZ_LR134475.1 Klebsiella aerogenes
9 1875767 1876063 - NZ_CP016043.1 Edwardsiella hoshinae
10 3549865 3550161 - NZ_CP023706.1 Edwardsiella tarda
11 3192326 3192625 - NZ_CP060111.1 Klebsiella michiganensis
12 3795058 3795354 - NZ_CP006664.1 Edwardsiella anguillarum ET080813
13 3136618 3136917 - NZ_CP036175.1 Klebsiella huaxiensis
14 2435343 2435642 + NZ_CP054254.1 Klebsiella variicola
15 2351880 2352179 + NZ_CP065838.1 Klebsiella quasipneumoniae
16 2887665 2887964 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00175.23 0.6 9 460.0 opposite-strand Oxidoreductase NAD-binding domain
++ More..