Protein Information |
Information Type | Description |
---|---|
Protein name | Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod (L-8.9/R) (Rod-capping linker protein) |
NCBI Accession ID | M93569.1 |
Organism | Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum) |
Left | 43 |
Right | 285 |
Strand | + |
Nucleotide Sequence | ATGTTGAGTCAATTTGCGAATGGAACGGAAGCGGCTTCGCGTGTTTTTACCTACGAAGTGCAAGGGCTGCGCCAAACAGAAGAAACAGACAATCAAGAATACGCCTTTCGTCGCAGTGGTAGTGTTTTTATCAATGTGCCCTATGCTCGGATGAATCAAGAGATGCAACGGATTTTGCGTCTAGGCGGCAAGATTGTTTCGATTAAACCTTATACGGGTGCGACTGCTTCTGACGAGGAATAA |
Sequence | MLSQFANGTEAASRVFTYEVQGLRQTEETDNQEYAFRRSGSVFINVPYARMNQEMQRILRLGGKIVSIKPYTGATASDEE |
Source of smORF | Swiss-Prot |
Function | Rod linker protein, associated with phycocyanin. Linker polypeptides determine the state of aggregation and the location of the disk-shaped phycobiliprotein units within the phycobilisome and modulate their spectroscopic properties in order to mediate a directed and optimal energy transfer. |
Pubmed ID | 1644801 2118804 |
Domain | CDD:413625 |
Functional Category | Others |
Uniprot ID | P31966 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2055043 | 2055267 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
2 | 2602382 | 2602585 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
3 | 4904287 | 4904550 | - | NZ_CP031941.1 | Nostoc sphaeroides |
4 | 1415277 | 1415540 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
5 | 1738153 | 1738395 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
6 | 2544943 | 2545203 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
7 | 3805705 | 3805944 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
8 | 1920294 | 1920530 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
9 | 2043768 | 2044004 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
10 | 6546715 | 6546972 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
11 | 2269570 | 2269806 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
12 | 1516829 | 1517083 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
13 | 6142735 | 6142986 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
14 | 1959296 | 1959505 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
15 | 176323 | 176562 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
16 | 3368122 | 3368364 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
17 | 2395420 | 2395632 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00502.21 | 1.0 | 17 | 2083 | same-strand | Phycobilisome protein |
2 | PF00427.23 | 1.0 | 17 | 1087.5 | same-strand | Phycobilisome Linker polypeptide |
3 | PF01383.23 | 1.0 | 17 | 233.0 | same-strand | CpcD/allophycocyanin linker domain |
4 | PF03130.18 | 0.76 | 13 | 40.5 | same-strand | PBS lyase HEAT-like repeat |