Result : P31900
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Hydrogenase maturation factor HypC |
| NCBI Accession ID | X70183.1 |
| Organism | Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) |
| Left | 2460 |
| Right | 2732 |
| Strand | + |
| Nucleotide Sequence | ATGTGCCTAGCGATTCCCGCACGTTTGGTGGAACTGCAAGCGGACCAGCAGGGCGTAGTCGACCTGAGCGGTGTACGTAAGACCATATCTCTCGCGCTGATGGCCGATGCCGTAGTCGGTGACTACGTCATCGTGCATGTCGGCTACGCGATTGGCAAGATCGATCCAGAGGAAGCAGAACGCACGCTGCGTCTGTTCGCGGAATTGGAGCGAGTGCAGCCGCCTGCGTCCGAGCCGATGCATGGGATGAACATTCATCAGGAGCCGGCATGA |
| Sequence | MCLAIPARLVELQADQQGVVDLSGVRKTISLALMADAVVGDYVIVHVGYAIGKIDPEEAERTLRLFAELERVQPPASEPMHGMNIHQEPA |
| Source of smORF | Swiss-Prot |
| Function | Involved in the maturation of [NiFe] hydrogenases. Involved in the biosynthesis of the Fe(CN)(2)CO cofactor. {ECO:0000250|UniProtKB:P0AAM3}. |
| Pubmed ID | 8352644 12948488 |
| Domain | CDD:412356 |
| Functional Category | Others |
| Uniprot ID | P31900 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 11209 | 11481 | + | NZ_CP039289.1 | Cupriavidus necator H16 |
| 2 | 448764 | 449045 | + | NZ_CP022992.1 | Paraburkholderia aromaticivorans |
| 3 | 2084624 | 2084881 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 4 | 3191423 | 3191656 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 5 | 2997243 | 2997488 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 6 | 2332492 | 2332758 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 7 | 2514025 | 2514270 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 8 | 4064719 | 4064964 | + | NZ_CP030265.1 | Skermanella pratensis |
| 9 | 1935165 | 1935404 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 10 | 227057 | 227305 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 11 | 2655987 | 2656250 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 12 | 772338 | 772595 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 13 | 2158125 | 2158364 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 14 | 4572615 | 4572857 | + | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 15 | 879009 | 879236 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 16 | 2751941 | 2752171 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 17 | 77016 | 77279 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 18 | 4369088 | 4369342 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 19 | 5113952 | 5114206 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 20 | 4035521 | 4035799 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 21 | 5506489 | 5506725 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 22 | 3873393 | 3873629 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 23 | 2238964 | 2239239 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 24 | 3165212 | 3165487 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 25 | 1934392 | 1934625 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 26 | 1560689 | 1560928 | - | NZ_CP049135.1 | Paraburkholderia tropica |
| 27 | 150923 | 151159 | - | NC_009929.1 | Acaryochloris marina MBIC11017 |
| 28 | 3582212 | 3582463 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP039289.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01155.21 | 0.75 | 21 | 2325 | same-strand | Hydrogenase/urease nickel incorporation, metallochaperone, hypA |
| 2 | PF02492.21 | 0.79 | 22 | 2267.5 | same-strand | CobW/HypB/UreG, nucleotide-binding domain |
| 3 | PF17788.3 | 0.79 | 22 | 2.5 | same-strand | HypF Kae1-like domain |
| 4 | PF01924.18 | 0.93 | 26 | -3.0 | same-strand | Hydrogenase formation hypA family |
| 5 | PF02769.24 | 0.96 | 27 | 1133 | same-strand | AIR synthase related protein, C-terminal domain |
| 6 | PF00586.26 | 0.96 | 27 | 1133 | same-strand | AIR synthase related protein, N-terminal domain |
++ More..