Result : P31881
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Hydrogenase maturation factor HypC |
| NCBI Accession ID | X63650.1 |
| Organism | Azotobacter vinelandii |
| Left | 4618 |
| Right | 4872 |
| Strand | + |
| Nucleotide Sequence | ATGTGCCTGGCCATTCCGGTCCGCATCGAGGAACTGCTCGACGAGCAGAGTGCGGTCGCCTGCATCGGCGGCCTGCGCAAGACCATCAACGTCGCCCTGCTCGACGATCTGAAAGTGGGCGACTACGTGATCCTGCACGTCGGCTTCGCCCTGCAGAAGCTCGACGAGGCCGAGGCGCAGCGCACCCTGGCGCTGCTCGCCGAGTTGGGCCGATTGGCCGAGGCCGAGCAGGCCGCGCAGGGAGAGGCGCCATGA |
| Sequence | MCLAIPVRIEELLDEQSAVACIGGLRKTINVALLDDLKVGDYVILHVGFALQKLDEAEAQRTLALLAELGRLAEAEQAAQGEAP |
| Source of smORF | Swiss-Prot |
| Function | Involved in the maturation of [NiFe] hydrogenases. Involved in the biosynthesis of the Fe(CN)(2)CO cofactor. {ECO:0000250|UniProtKB:P0AAM3}. |
| Pubmed ID | 1610901 |
| Domain | CDD:412356 |
| Functional Category | Others |
| Uniprot ID | P31881 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5113952 | 5114206 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 2 | 2907420 | 2907674 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 3 | 4369088 | 4369342 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 4 | 1713307 | 1713552 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 5 | 1447876 | 1448121 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 6 | 2964332 | 2964577 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 7 | 2445514 | 2445759 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 8 | 1416045 | 1416278 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 9 | 1812500 | 1812745 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 10 | 2080422 | 2080655 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 11 | 2037174 | 2037416 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 12 | 77016 | 77279 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 13 | 967782 | 968006 | + | NZ_CP044331.1 | Methylocystis parvus |
| 14 | 4064719 | 4064964 | + | NZ_CP030265.1 | Skermanella pratensis |
| 15 | 2850487 | 2850729 | - | NZ_CP029495.1 | Chromobacterium phragmitis |
| 16 | 2069955 | 2070200 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 17 | 2759238 | 2759495 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 18 | 716045 | 716275 | + | NZ_LR134374.1 | Legionella spiritensis |
| 19 | 2891813 | 2892073 | + | NZ_CP014646.1 | Thauera humireducens |
| 20 | 1188224 | 1188460 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 21 | 2950498 | 2950713 | + | NZ_AP018907.1 | Blastochloris tepida |
| 22 | 2084624 | 2084881 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 23 | 772338 | 772595 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 24 | 2808282 | 2808497 | - | NZ_CP012946.1 | Blastochloris viridis |
| 25 | 2514025 | 2514270 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 26 | 2158125 | 2158364 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 27 | 2350553 | 2350789 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 28 | 7562343 | 7562579 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 29 | 1834137 | 1834370 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 30 | 222713 | 222940 | + | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 31 | 2871798 | 2872025 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 32 | 1509867 | 1510091 | + | NZ_LN614830.1 | Tatlockia micdadei |
| 33 | 4248271 | 4248510 | + | NZ_CP016210.1 | Azoarcus olearius |
| 34 | 61104 | 61340 | + | NZ_CP022220.1 | Bradyrhizobium guangxiense |
| 35 | 832732 | 832968 | + | NZ_CP030054.1 | Bradyrhizobium guangzhouense |
| 36 | 653139 | 653375 | + | NZ_CP030052.1 | Bradyrhizobium guangdongense |
| 37 | 5779805 | 5780041 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 38 | 227057 | 227305 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 39 | 69334 | 69621 | + | NZ_CP039289.1 | Cupriavidus necator H16 |
| 40 | 2424344 | 2424574 | - | NZ_CP038254.1 | Legionella israelensis |
| 41 | 1560689 | 1560928 | - | NZ_CP049135.1 | Paraburkholderia tropica |
| 42 | 2335146 | 2335382 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 43 | 1779181 | 1779417 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 44 | 870609 | 870839 | + | NZ_LR699119.1 | Aquicella siphonis |
| 45 | 120416 | 120643 | - | NZ_CP032696.1 | Rhizobium jaguaris |
| 46 | 296235 | 296474 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 47 | 1042006 | 1042251 | + | NZ_CP064781.1 | Azospira restricta |
| 48 | 1484295 | 1484519 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 49 | 2332019 | 2332249 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 50 | 2997243 | 2997488 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 51 | 2473524 | 2473751 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 52 | 1061008 | 1061241 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 53 | 2289723 | 2289950 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 54 | 1830037 | 1830279 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 55 | 1031088 | 1031345 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 56 | 2751941 | 2752171 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 57 | 2118912 | 2119160 | + | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 58 | 2332492 | 2332758 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 59 | 187663 | 187881 | + | NZ_CP015322.1 | Mesorhizobium amorphae CCNWGS0123 |
| 60 | 4572615 | 4572857 | + | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 61 | 341023 | 341271 | - | NZ_CP053710.1 | Lichenicola cladoniae |
| 62 | 1508618 | 1508845 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 63 | 323559 | 323783 | + | NZ_CP054617.1 | Azospirillum oryzae |
| 64 | 1052061 | 1052294 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 65 | 1722928 | 1723161 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 66 | 7154766 | 7154999 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 67 | 118357 | 118584 | + | NZ_CP041240.1 | Ensifer mexicanus |
| 68 | 438561 | 438815 | + | NZ_CP054836.1 | Oricola thermophila |
| 69 | 2114740 | 2114973 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 70 | 3873393 | 3873629 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 71 | 3191423 | 3191656 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 72 | 2200879 | 2201103 | + | NZ_CP016796.1 | Francisella uliginis |
| 73 | 1963995 | 1964237 | - | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 74 | 159728 | 159955 | - | NC_020061.1 | Rhizobium tropici CIAT 899 |
| 75 | 209877 | 210107 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 76 | 214461 | 214739 | - | NC_003551.1 | Methanopyrus kandleri AV19 |
| 77 | 6622025 | 6622255 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 78 | 66776 | 67003 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
| 79 | 559872 | 560099 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 80 | 1570983 | 1571231 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 81 | 35822 | 36100 | + | NZ_CP010858.1 | Marinovum algicola DG 898 |
| 82 | 3096499 | 3096750 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 83 | 3582212 | 3582463 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012560.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02769.24 | 0.95 | 76 | 1136 | same-strand | AIR synthase related protein, C-terminal domain |
| 2 | PF00586.26 | 0.94 | 75 | 1136.0 | same-strand | AIR synthase related protein, N-terminal domain |
| 3 | PF01924.18 | 0.95 | 76 | -3 | same-strand | Hydrogenase formation hypA family |
| 4 | PF01300.20 | 0.7 | 56 | 2 | same-strand | Telomere recombination |
| 5 | PF17788.3 | 0.88 | 70 | 3.0 | same-strand | HypF Kae1-like domain |
| 6 | PF07503.14 | 0.71 | 57 | 2.0 | same-strand | HypF finger |
| 7 | PF00708.20 | 0.71 | 57 | 2.0 | same-strand | Acylphosphatase |
| 8 | PF02492.21 | 0.84 | 67 | 2276.0 | same-strand | CobW/HypB/UreG, nucleotide-binding domain |
| 9 | PF01155.21 | 0.78 | 62 | 3163 | same-strand | Hydrogenase/urease nickel incorporation, metallochaperone, hypA |
++ More..