Protein Information |
Information Type | Description |
---|---|
Protein name | Hemin uptake protein HemP |
NCBI Accession ID | X68147.1 |
Organism | Yersinia enterocolitica |
Left | 373 |
Right | 618 |
Strand | + |
Nucleotide Sequence | ATGATTGATAATGCTTATCATATTGATAGCGGTTATCATTACCTTGTTTGCAATATGGATAAACAGTTGAACAAAGCACCCACAATGAATGACGAACCTGCGGCCAAACCGCCTGCGGGCAACAAGCCCCTGTCTGTCTCCAGCGAGCAATTGCTGGGAGAGCATGGTGTCGCTTTTATCATCCATCAGGGCGAATGCTATCAGCTGCGCCAGACCAAAGCAGGGAAACTGATACTGACTAAATAA |
Sequence | MIDNAYHIDSGYHYLVCNMDKQLNKAPTMNDEPAAKPPAGNKPLSVSSEQLLGEHGVAFIIHQGECYQLRQTKAGKLILTK |
Source of smORF | Swiss-Prot |
Function | This protein is involved in the uptake of hemin. |
Pubmed ID | 1425573 |
Domain | CDD:415835 |
Functional Category | Others |
Uniprot ID | P31516 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4270709 | 4270954 | + | NZ_CP011118.1 | Yersinia enterocolitica |
2 | 358478 | 358723 | - | NZ_CP043727.1 | Yersinia canariae |
3 | 401690 | 401935 | - | NZ_CP032487.1 | Yersinia hibernica |
4 | 3287466 | 3287711 | - | NZ_CP009787.1 | Yersinia rohdei |
5 | 1671852 | 1672097 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
6 | 1290830 | 1291027 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04055.23 | 1.0 | 6 | 1221.0 | same-strand | Radical SAM superfamily |
2 | PF06228.15 | 1.0 | 6 | 1497.0 | same-strand | Haem utilisation ChuX/HutX |
3 | PF05171.14 | 1.0 | 6 | 1497.0 | same-strand | Haemin-degrading HemS.ChuX domain |
4 | PF13460.8 | 0.83 | 5 | 47 | same-strand | NAD(P)H-binding |
5 | PF00593.26 | 1.0 | 6 | 155.0 | same-strand | TonB dependent receptor |
6 | PF07715.17 | 1.0 | 6 | 155.0 | same-strand | TonB-dependent Receptor Plug Domain |
7 | PF01497.20 | 1.0 | 6 | 3348.5 | same-strand | Periplasmic binding protein |
8 | PF01032.20 | 1.0 | 6 | 4184.5 | same-strand | FecCD transport family |
9 | PF00005.29 | 1.0 | 6 | 5189.0 | same-strand | ABC transporter |
10 | PF13191.8 | 1.0 | 6 | 5189.0 | same-strand | AAA ATPase domain |