ProsmORF-pred
Result : P31516
Protein Information
Information Type Description
Protein name Hemin uptake protein HemP
NCBI Accession ID X68147.1
Organism Yersinia enterocolitica
Left 373
Right 618
Strand +
Nucleotide Sequence ATGATTGATAATGCTTATCATATTGATAGCGGTTATCATTACCTTGTTTGCAATATGGATAAACAGTTGAACAAAGCACCCACAATGAATGACGAACCTGCGGCCAAACCGCCTGCGGGCAACAAGCCCCTGTCTGTCTCCAGCGAGCAATTGCTGGGAGAGCATGGTGTCGCTTTTATCATCCATCAGGGCGAATGCTATCAGCTGCGCCAGACCAAAGCAGGGAAACTGATACTGACTAAATAA
Sequence MIDNAYHIDSGYHYLVCNMDKQLNKAPTMNDEPAAKPPAGNKPLSVSSEQLLGEHGVAFIIHQGECYQLRQTKAGKLILTK
Source of smORF Swiss-Prot
Function This protein is involved in the uptake of hemin.
Pubmed ID 1425573
Domain CDD:415835
Functional Category Others
Uniprot ID P31516
ORF Length (Amino Acid) 81
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 6
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4270709 4270954 + NZ_CP011118.1 Yersinia enterocolitica
2 358478 358723 - NZ_CP043727.1 Yersinia canariae
3 401690 401935 - NZ_CP032487.1 Yersinia hibernica
4 3287466 3287711 - NZ_CP009787.1 Yersinia rohdei
5 1671852 1672097 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
6 1290830 1291027 - NZ_CP007044.2 Chania multitudinisentens RB-25
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP011118.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF04055.23 1.0 6 1221.0 same-strand Radical SAM superfamily
2 PF06228.15 1.0 6 1497.0 same-strand Haem utilisation ChuX/HutX
3 PF05171.14 1.0 6 1497.0 same-strand Haemin-degrading HemS.ChuX domain
4 PF13460.8 0.83 5 47 same-strand NAD(P)H-binding
5 PF00593.26 1.0 6 155.0 same-strand TonB dependent receptor
6 PF07715.17 1.0 6 155.0 same-strand TonB-dependent Receptor Plug Domain
7 PF01497.20 1.0 6 3348.5 same-strand Periplasmic binding protein
8 PF01032.20 1.0 6 4184.5 same-strand FecCD transport family
9 PF00005.29 1.0 6 5189.0 same-strand ABC transporter
10 PF13191.8 1.0 6 5189.0 same-strand AAA ATPase domain
++ More..