Protein Information |
Information Type | Description |
---|---|
Protein name | Multiple antibiotic resistance protein MarB |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1619989 |
Right | 1620207 |
Strand | + |
Nucleotide Sequence | ATGAAACCACTTTCATCCGCAATAGCAGCTGCGCTTATTCTCTTTTCCGCGCAGGGCGTTGCGGAACAAACCACGCAGCCAGTTGTTACTTCTTGTGCCAATGTCGTGGTTGTTCCCCCATCGCAGGAACACCCACCGTTTGATTTAAATCACATGGGTACTGGCAGTGATAAGTCGGATGCGCTCGGCGTGCCCTATTATAATCAACACGCTATGTAG |
Sequence | MKPLSSAIAAALILFSAQGVAEQTTQPVVTSCANVVVVPPSQEHPPFDLNHMGTGSDKSDALGVPYYNQHAM |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23980. Profile Description: MarB protein. The MarB protein is found in the multiple antibiotic resistance (mar) locus in Escherichia coli. The MarB protein is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 70 amino acids in length. There is a conserved GSDKSD sequence motif. |
Pubmed ID | 8383113 8491710 9097039 9278503 16738553 |
Domain | CDD:420130 |
Functional Category | Others |
Uniprot ID | P31121 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1619989 | 1620207 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1595523 | 1595741 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 2144537 | 2144755 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 2159917 | 2160135 | - | NZ_LR134340.1 | Escherichia marmotae |
5 | 1578754 | 1578972 | + | NZ_AP014857.1 | Escherichia albertii |
6 | 1505593 | 1505811 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
7 | 3752400 | 3752618 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
8 | 10727 | 10945 | + | NZ_CP044098.1 | Citrobacter portucalensis |
9 | 69882 | 70100 | - | NZ_CP033744.1 | Citrobacter freundii |
10 | 2203783 | 2204001 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
11 | 3231174 | 3231392 | + | NZ_CP045205.1 | Citrobacter telavivensis |
12 | 898503 | 898721 | - | NZ_CP038469.1 | Citrobacter tructae |
13 | 1101803 | 1102015 | - | NZ_CP023529.1 | Lelliottia amnigena |
14 | 2858509 | 2858727 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
15 | 2313479 | 2313697 | - | NC_015968.1 | Enterobacter soli |
16 | 2333705 | 2333923 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
17 | 2522217 | 2522435 | - | NZ_CP043318.1 | Enterobacter chengduensis |
18 | 1498539 | 1498757 | - | NZ_CP017279.1 | Enterobacter ludwigii |
19 | 3598131 | 3598337 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
20 | 2250788 | 2251006 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
21 | 2281879 | 2282061 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
22 | 250600 | 250818 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
23 | 2277393 | 2277611 | - | NZ_AP022508.1 | Enterobacter bugandensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07690.18 | 1.0 | 22 | 1772 | same-strand | Major Facilitator Superfamily |
2 | PF01914.19 | 1.0 | 22 | 1125 | opposite-strand | MarC family integral membrane protein |
3 | PF01047.24 | 1.0 | 22 | 435 | same-strand | MarR family |
4 | PF12802.9 | 0.91 | 20 | 435 | same-strand | MarR family |
5 | PF12833.9 | 1.0 | 22 | 32.5 | same-strand | Helix-turn-helix domain |
6 | PF00165.25 | 1.0 | 22 | 32.5 | same-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
7 | PF00892.22 | 0.95 | 21 | 34.5 | opposite-strand | EamA-like transporter family |
8 | PF00005.29 | 0.64 | 14 | 3081.5 | opposite-strand | ABC transporter |