Protein Information |
Information Type | Description |
---|---|
Protein name | Heme exporter protein D (Cytochrome c-type biogenesis protein CycX) |
NCBI Accession ID | M60874.1 |
Organism | Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) |
Left | 2848 |
Right | 3033 |
Strand | + |
Nucleotide Sequence | ATGATCATGTCGCTCGGTCCCTATGCCTCCTTCATCGTGACGTCTTATGCCGCAGCCGCGCTCGTGGTCGCGATCCTGATCGGCTGGATCGCGACCGACTATCGCAGCCAGACCCGCCGCCTGCGCGACCTCGACCGCAGCGGCATCACCCGCCGCTCGGGGCGCAGCGCGATGGATCGGCCATGA |
Sequence | MIMSLGPYASFIVTSYAAAALVVAILIGWIATDYRSQTRRLRDLDRSGITRRSGRSAMDRP |
Source of smORF | Swiss-Prot |
Function | Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. {ECO:0000305}. |
Pubmed ID | 1850420 12597275 |
Domain | |
Functional Category | Others |
Uniprot ID | P30959 |
ORF Length (Amino Acid) | 61 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 441615 | 441800 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
2 | 372311 | 372496 | - | NC_017082.1 | Bradyrhizobium cosmicum |
3 | 3391462 | 3391647 | - | NZ_CP044543.1 | Bradyrhizobium betae |
4 | 419620 | 419805 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
5 | 2566336 | 2566518 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
6 | 567445 | 567630 | - | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
7 | 357798 | 357983 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
8 | 397715 | 397900 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
9 | 449832 | 450029 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
10 | 2230945 | 2231094 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
11 | 7033253 | 7033402 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
12 | 7323 | 7472 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
13 | 394624 | 394809 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
14 | 416746 | 416925 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
15 | 8144832 | 8145011 | + | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
16 | 8154224 | 8154400 | + | NZ_CP016428.1 | Bradyrhizobium icense |
17 | 7023133 | 7023318 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
18 | 225901 | 226074 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
19 | 3566707 | 3566904 | + | NC_015684.1 | Afipia carboxidovorans OM5 |
20 | 453687 | 453866 | + | NC_007964.1 | Nitrobacter hamburgensis X14 |
21 | 356221 | 356370 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
22 | 1236745 | 1236918 | - | NZ_AP014946.1 | Variibacter gotjawalensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00330.22 | 0.95 | 20 | 2631 | opposite-strand | Aconitase family (aconitate hydratase) |
2 | PF00694.21 | 0.95 | 20 | 2631 | opposite-strand | Aconitase C-terminal domain |
3 | PF00005.29 | 1.0 | 21 | 1799.0 | same-strand | ABC transporter |
4 | PF03379.15 | 1.0 | 21 | 868.0 | same-strand | CcmB protein |
5 | PF01578.22 | 1.0 | 21 | -3.0 | same-strand | Cytochrome C assembly protein |
6 | PF08534.12 | 1.0 | 21 | -3.0 | same-strand | Redoxin |
7 | PF00578.23 | 1.0 | 21 | -3.0 | same-strand | AhpC/TSA family |
8 | PF13905.8 | 1.0 | 21 | -3.0 | same-strand | Thioredoxin-like |
9 | PF04279.17 | 0.9 | 19 | 728.0 | opposite-strand | Intracellular septation protein A |
10 | PF00448.24 | 0.86 | 18 | 1421 | opposite-strand | SRP54-type protein, GTPase domain |
11 | PF02881.21 | 0.86 | 18 | 1421 | opposite-strand | SRP54-type protein, helical bundle domain |
12 | PF13401.8 | 0.81 | 17 | 1413.0 | opposite-strand | AAA domain |
13 | PF00849.24 | 0.86 | 18 | 2418 | same-strand | RNA pseudouridylate synthase |
14 | PF06764.13 | 0.86 | 18 | 5581 | opposite-strand | Protein of unknown function (DUF1223) |