Result : P30345
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Mercuric transport protein (Mercury ion transport protein) |
| NCBI Accession ID | X65467.1 |
| Organism | Streptomyces lividans |
| Left | 1854 |
| Right | 2156 |
| Strand | - |
| Nucleotide Sequence | ATGACGCCTCCGCCCACCCAGCCCGGTGACCGCCGCGGCGGCCTGCTCGGCACCCTCGCCGTCGTCGGCGTCGCCCTGCTGCCGATCATCTGCTGCGCCGGGCCGGTGCTGCTGGCCAGCGGCGCCCTGGCCGGACTCGGCGGGGTGCTGGTCAGCCCCTGGCTGCTGGCCCCGGCCGCGGTCCTGCTGGCCGGCGCTCTCACCTGGTGGCTGCGCCGCCGCCGCACCGGCAACGGCGATGCCTGCTGCCTCCCGGCCCCCCGCACCGACCAGCACGACCGCGACCTGCTCCGCAAGCAGTGA |
| Sequence | MTPPPTQPGDRRGGLLGTLAVVGVALLPIICCAGPVLLASGALAGLGGVLVSPWLLAPAAVLLAGALTWWLRRRRTGNGDACCLPAPRTDQHDRDLLRKQ |
| Source of smORF | Swiss-Prot |
| Function | Involved in mercuric transport. Passes a mercury ion from the MerP protein to the mercuric reductase MerA. |
| Pubmed ID | 1494353 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | P30345 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5367447 | 5367749 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 2 | 33051 | 33350 | - | NC_015314.1 | Pseudonocardia dioxanivorans CB1190 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP023202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 1.0 | 2 | 1694.5 | both-strands | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF02852.24 | 1.0 | 2 | 1694.5 | both-strands | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 3 | PF00070.29 | 1.0 | 2 | 1694.5 | both-strands | Pyridine nucleotide-disulphide oxidoreductase |
| 4 | PF07884.16 | 1.0 | 2 | 1732.5 | same-strand | Vitamin K epoxide reductase family |
| 5 | PF02683.17 | 1.0 | 2 | 692.5 | same-strand | Cytochrome C biogenesis protein transmembrane region |
| 6 | PF11139.10 | 1.0 | 2 | 692.5 | same-strand | Sap, sulfolipid-1-addressing protein |
| 7 | PF13905.8 | 1.0 | 2 | 125.0 | same-strand | Thioredoxin-like |
| 8 | PF00578.23 | 1.0 | 2 | 125.0 | same-strand | AhpC/TSA family |
| 9 | PF01022.22 | 1.0 | 2 | -3.0 | same-strand | Bacterial regulatory protein, arsR family |
| 10 | PF12840.9 | 1.0 | 2 | -3.0 | same-strand | Helix-turn-helix domain |
| 11 | PF12802.9 | 1.0 | 2 | -3.0 | same-strand | MarR family |
| 12 | PF12324.10 | 1.0 | 2 | 1961.0 | opposite-strand | Helix-turn-helix domain of alkylmercury lyase |
++ More..