Result : P29963
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Heme exporter protein D (Cytochrome c-type biogenesis protein HelD) |
| NCBI Accession ID | M96013.1 |
| Organism | Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) |
| Left | 62 |
| Right | 220 |
| Strand | + |
| Nucleotide Sequence | ATGATGCCGGAGTTCGGAAAATACGCCGTCACGATCCTTGCGTCCTGGGGGGCGACGCTTGTGCTGCTGGCGGGGCTGATCGCGGCCACGCTGATCCGCGGCGCGCAGGTGAAACGGGCGTTGAAAGCCCAGGAAGAACGGATGAAGAACGATGGCTAA |
| Sequence | MMPEFGKYAVTILASWGATLVLLAGLIAATLIRGAQVKRALKAQEERMKNDG |
| Source of smORF | Swiss-Prot |
| Function | Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. {ECO:0000305}. |
| Pubmed ID | 1310666 8384715 20418398 |
| Domain | CDD:416290 |
| Functional Category | Others |
| Uniprot ID | P29963 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1441995 | 1442153 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 2 | 1635001 | 1635156 | + | NZ_CP004393.1 | Celeribacter indicus |
| 3 | 1559422 | 1559580 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 4 | 1270078 | 1270236 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 5 | 1511879 | 1512022 | - | NZ_CP045073.1 | Paracoccus kondratievae |
| 6 | 1383613 | 1383768 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 7 | 1747848 | 1748003 | - | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 8 | 2289535 | 2289696 | - | NZ_CP012661.1 | Defluviimonas alba |
| 9 | 3229334 | 3229477 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02355.18 | 0.78 | 7 | 2574 | same-strand | Protein export membrane protein |
| 2 | PF04430.16 | 0.89 | 8 | 2131.0 | same-strand | Protein of unknown function (DUF498/DUF598) |
| 3 | PF00005.29 | 0.89 | 8 | 1439.0 | same-strand | ABC transporter |
| 4 | PF03379.15 | 1.0 | 9 | 786 | same-strand | CcmB protein |
| 5 | PF01578.22 | 1.0 | 9 | -3 | same-strand | Cytochrome C assembly protein |
| 6 | PF08534.12 | 0.78 | 7 | -7 | same-strand | Redoxin |
| 7 | PF00578.23 | 1.0 | 9 | -7 | same-strand | AhpC/TSA family |
| 8 | PF13905.8 | 0.89 | 8 | -7.0 | same-strand | Thioredoxin-like |
| 9 | PF13098.8 | 0.67 | 6 | -7.0 | same-strand | Thioredoxin-like domain |
++ More..