Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YjbT |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 4239777 |
Right | 4240055 |
Strand | - |
Nucleotide Sequence | ATGAAACGTAACCTGATAAAGGTGGTAAAAATGAAGCCTTATTTTGCTGCTTTGATGTTATCAGTCTCTGTTCTTCCTGCTTATGCTGGTCCGCTCGGTACTGCTGATAAAGCCGACCTACCGCAAAGCAATGTCTCCAGCCCAATGATGGCCCAGTCGCTCAGGCAACCAGACCTGCAACCGATATCGACGGACAGGAAGACAGAATGTTTTCGCCTTTACACACCAGATCGCAAACCGGGAGTGAACTGCGTTCCTGATGGCTCGACAGGCCATTAA |
Sequence | MKRNLIKVVKMKPYFAALMLSVSVLPAYAGPLGTADKADLPQSNVSSPMMAQSLRQPDLQPISTDRKTECFRLYTPDRKPGVNCVPDGSTGH |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17089. Profile Description: Uncharacterized protein family. This is a family of bacterial proteins. The function is unknown. |
Pubmed ID | 9278503 |
Domain | CDD:293694 |
Functional Category | Others |
Uniprot ID | A5A628 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4349634 | 4349912 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
2 | 4239777 | 4240055 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 5093178 | 5093456 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 4035032 | 4035310 | - | NZ_CP061527.1 | Shigella dysenteriae |
5 | 4214327 | 4214605 | - | NZ_AP014857.1 | Escherichia albertii |
6 | 277915 | 278139 | - | NZ_LR134340.1 | Escherichia marmotae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01547.27 | 0.8 | 4 | 5173 | same-strand | Bacterial extracellular solute-binding protein |
2 | PF13416.8 | 0.8 | 4 | 5173 | same-strand | Bacterial extracellular solute-binding protein |
3 | PF14785.8 | 0.8 | 4 | 3475 | same-strand | Maltose transport system permease protein MalF P2 domain |
4 | PF00528.24 | 0.8 | 4 | 2570.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
5 | PF06146.14 | 1.0 | 5 | 270.0 | opposite-strand | Phosphate-starvation-inducible E family |
6 | PF06082.13 | 0.6 | 3 | 47.0 | opposite-strand | Exopolysaccharide biosynthesis protein YbjH |
7 | PF06251.13 | 0.8 | 4 | 2143 | opposite-strand | Capsule biosynthesis GfcC |
8 | PF11102.10 | 0.8 | 4 | 2877 | opposite-strand | Group 4 capsule polysaccharide lipoprotein gfcB, YjbF |
9 | PF11106.10 | 0.6 | 3 | 3629.0 | opposite-strand | Exopolysaccharide production protein YjbE |
10 | PF00342.21 | 0.8 | 4 | 4370 | opposite-strand | Phosphoglucose isomerase |