Result : P29907
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 9.3 kDa protein in nqo2 3'region (URF1) |
| NCBI Accession ID | M74171.1 |
| Organism | Paracoccus denitrificans |
| Left | 1419 |
| Right | 1682 |
| Strand | + |
| Nucleotide Sequence | ATGGCCCGCCCGGCAGGACATGCGGCGTCGCAGGCGGGTGGGACCGCTGCGGCGGATGCCCGGCAGATGCGTCTGGTGGCGGCGGTGATCGCCGTCACCATGGCGCTGTGGCTGGGGGTGCAATGGCTGGGGGGCCAGCAGGACTGGCCCGCGAAATATGCCTTTCTCGCCGATCTGGCGGCGATTGGGGCCTTGATCTGGTCGCTTTTGGTGACCTTTCGGATCTGGCGGCGGCGCAAGGCGTCCTCGCAGGGACAAGGATAA |
| Sequence | MARPAGHAASQAGGTAAADARQMRLVAAVIAVTMALWLGVQWLGGQQDWPAKYAFLADLAAIGALIWSLLVTFRIWRRRKASSQGQG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17272. Profile Description: Family of unknown function (DUF5337). This family of unknown function is found in Rhodobacterales. Most members are predicted to have 2 trans-membrane regions. |
| Pubmed ID | 1909571 |
| Domain | CDD:407385 |
| Functional Category | Others |
| Uniprot ID | P29907 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 497365 | 497628 | + | NZ_CP045072.1 | Paracoccus kondratievae |
| 2 | 852863 | 853126 | + | NZ_LN832559.1 | Paracoccus aminovorans |
| 3 | 2627416 | 2627664 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 4 | 2154925 | 2155173 | + | NZ_CP024422.1 | Paracoccus yeei |
| 5 | 358326 | 358556 | + | NZ_CP025583.1 | Paracoccus jeotgali |
| 6 | 525369 | 525611 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 7 | 63406 | 63621 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 8 | 287116 | 287346 | - | NZ_CP020612.1 | Paracoccus contaminans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045072.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00329.21 | 0.88 | 7 | 2862 | same-strand | Respiratory-chain NADH dehydrogenase, 30 Kd subunit |
| 2 | PF00346.21 | 1.0 | 8 | 1513.0 | same-strand | Respiratory-chain NADH dehydrogenase, 49 Kd subunit |
| 3 | PF01257.21 | 1.0 | 8 | 682.0 | same-strand | Thioredoxin-like [2Fe-2S] ferredoxin |
| 4 | PF01512.19 | 1.0 | 8 | 7.0 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 5 | PF10589.11 | 0.88 | 7 | 7 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 6 | PF10531.11 | 1.0 | 8 | 7.0 | same-strand | SLBB domain |
| 7 | PF17267.4 | 0.88 | 7 | 1461 | same-strand | Family of unknown function (DUF5333) |
| 8 | PF10588.11 | 0.75 | 6 | 2371.0 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 9 | PF13510.8 | 0.75 | 6 | 2371.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
++ More..