Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized 9.3 kDa protein in nqo2 3'region (URF1) |
NCBI Accession ID | M74171.1 |
Organism | Paracoccus denitrificans |
Left | 1419 |
Right | 1682 |
Strand | + |
Nucleotide Sequence | ATGGCCCGCCCGGCAGGACATGCGGCGTCGCAGGCGGGTGGGACCGCTGCGGCGGATGCCCGGCAGATGCGTCTGGTGGCGGCGGTGATCGCCGTCACCATGGCGCTGTGGCTGGGGGTGCAATGGCTGGGGGGCCAGCAGGACTGGCCCGCGAAATATGCCTTTCTCGCCGATCTGGCGGCGATTGGGGCCTTGATCTGGTCGCTTTTGGTGACCTTTCGGATCTGGCGGCGGCGCAAGGCGTCCTCGCAGGGACAAGGATAA |
Sequence | MARPAGHAASQAGGTAAADARQMRLVAAVIAVTMALWLGVQWLGGQQDWPAKYAFLADLAAIGALIWSLLVTFRIWRRRKASSQGQG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17272. Profile Description: Family of unknown function (DUF5337). This family of unknown function is found in Rhodobacterales. Most members are predicted to have 2 trans-membrane regions. |
Pubmed ID | 1909571 |
Domain | CDD:407385 |
Functional Category | Others |
Uniprot ID | P29907 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 497365 | 497628 | + | NZ_CP045072.1 | Paracoccus kondratievae |
2 | 852863 | 853126 | + | NZ_LN832559.1 | Paracoccus aminovorans |
3 | 2627416 | 2627664 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
4 | 2154925 | 2155173 | + | NZ_CP024422.1 | Paracoccus yeei |
5 | 358326 | 358556 | + | NZ_CP025583.1 | Paracoccus jeotgali |
6 | 525369 | 525611 | + | NZ_CP060436.1 | Pseudooceanicola algae |
7 | 63406 | 63621 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
8 | 287116 | 287346 | - | NZ_CP020612.1 | Paracoccus contaminans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00329.21 | 0.88 | 7 | 2862 | same-strand | Respiratory-chain NADH dehydrogenase, 30 Kd subunit |
2 | PF00346.21 | 1.0 | 8 | 1513.0 | same-strand | Respiratory-chain NADH dehydrogenase, 49 Kd subunit |
3 | PF01257.21 | 1.0 | 8 | 682.0 | same-strand | Thioredoxin-like [2Fe-2S] ferredoxin |
4 | PF01512.19 | 1.0 | 8 | 7.0 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
5 | PF10589.11 | 0.88 | 7 | 7 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
6 | PF10531.11 | 1.0 | 8 | 7.0 | same-strand | SLBB domain |
7 | PF17267.4 | 0.88 | 7 | 1461 | same-strand | Family of unknown function (DUF5333) |
8 | PF10588.11 | 0.75 | 6 | 2371.0 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
9 | PF13510.8 | 0.75 | 6 | 2371.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |