Result : P29432
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | M80817.1 |
| Organism | Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) |
| Left | 824 |
| Right | 1081 |
| Strand | - |
| Nucleotide Sequence | ATGGTCAAACTATCAACGATAGTTGTTTTTTGTTTAACTTTTTTCGTTTCGATTTATCAAAATTATATTAGTTTTTTTATGCCTTCAAATTGTCGTTTTTATCCTACTTGCTCAACATATATGATTTTATCTTTGCGTAAATTTGGAGTTATCAAAGGTATAATTTTAACAATTTTACGTTTATTTAAATGTCATCCATTGCATCAAGGTGGAGAAGATTTAGTGCCTTTAAAAATTAAAGATAAAAGTGAATATTAA |
| Sequence | MVKLSTIVVFCLTFFVSIYQNYISFFMPSNCRFYPTCSTYMILSLRKFGVIKGIILTILRLFKCHPLHQGGEDLVPLKIKDKSEY |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 1572539 9516544 12089438 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | P29432 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 99
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1022710 | 1022934 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 2 | 2610329 | 2610571 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 378272 | 378487 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 4 | 4071787 | 4072044 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 4448647 | 4448904 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2449458 | 2449715 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 7 | 1855579 | 1855836 | + | NZ_CP053416.1 | Salmonella bongori |
| 8 | 2888876 | 2889133 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 4634514 | 4634771 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 10 | 3884816 | 3885073 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 3859414 | 3859671 | + | NZ_AP014857.1 | Escherichia albertii |
| 12 | 4709704 | 4709961 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 13 | 48967 | 49224 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 14 | 4747406 | 4747663 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 15 | 4811953 | 4812210 | - | NC_015968.1 | Enterobacter soli |
| 16 | 2582500 | 2582757 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 17 | 3427535 | 3427780 | - | NZ_CP038469.1 | Citrobacter tructae |
| 18 | 4847429 | 4847686 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 19 | 3233296 | 3233541 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 20 | 4046178 | 4046435 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 21 | 3565571 | 3565816 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 22 | 2417996 | 2418241 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 23 | 2666793 | 2667038 | + | NZ_CP033744.1 | Citrobacter freundii |
| 24 | 1367090 | 1367335 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 25 | 5110091 | 5110348 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 26 | 4261530 | 4261775 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 27 | 456657 | 456914 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 28 | 3486254 | 3486511 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 29 | 4771184 | 4771441 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 30 | 1722754 | 1722999 | + | NZ_CP026047.1 | Raoultella planticola |
| 31 | 5574299 | 5574544 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 32 | 5067236 | 5067442 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 33 | 2825783 | 2826040 | - | NZ_CP049115.1 | Pantoea stewartii |
| 34 | 5597097 | 5597342 | - | NZ_CP050508.1 | Raoultella terrigena |
| 35 | 1724196 | 1724462 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 36 | 5265069 | 5265314 | - | NZ_CP041247.1 | Raoultella electrica |
| 37 | 5189132 | 5189377 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 38 | 4691231 | 4691488 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 39 | 3742796 | 3743053 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 40 | 2618145 | 2618387 | + | NZ_CP012024.1 | Bacillus smithii |
| 41 | 876224 | 876433 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 42 | 1775858 | 1776133 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 43 | 1732750 | 1732995 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 44 | 3306198 | 3306425 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 45 | 4585146 | 4585403 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 46 | 5241329 | 5241574 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 47 | 5300722 | 5300967 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 48 | 5540913 | 5541158 | - | NZ_CP054254.1 | Klebsiella variicola |
| 49 | 4028387 | 4028644 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 50 | 4034663 | 4034920 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 51 | 4048841 | 4049098 | - | NZ_CP038853.1 | Pantoea vagans |
| 52 | 4265068 | 4265325 | - | NZ_CP061511.1 | Mixta calida |
| 53 | 41784 | 42041 | - | NZ_CP026377.1 | Mixta gaviniae |
| 54 | 48532 | 48789 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 55 | 6182251 | 6182508 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 56 | 4608746 | 4609003 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 57 | 1588440 | 1588697 | + | NZ_CP007230.1 | Yersinia similis |
| 58 | 4157224 | 4157469 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 59 | 3299588 | 3299845 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 60 | 1226279 | 1226524 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 61 | 2687905 | 2688150 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 62 | 1804563 | 1804784 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 63 | 1399590 | 1399820 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 64 | 898720 | 898947 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 65 | 3974675 | 3974884 | - | NZ_LS483470.1 | Leminorella richardii |
| 66 | 1670625 | 1670900 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 67 | 731136 | 731345 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 68 | 3177067 | 3177288 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 69 | 1473010 | 1473246 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 70 | 2509276 | 2509509 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 71 | 1090070 | 1090291 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 72 | 4194540 | 4194758 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 73 | 3779468 | 3779683 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 74 | 1568150 | 1568371 | - | NZ_CP026364.1 | Proteus hauseri |
| 75 | 2941799 | 2942026 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 76 | 1028217 | 1028435 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 77 | 401402 | 401620 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 78 | 1823033 | 1823269 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 79 | 1331115 | 1331330 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 80 | 121779 | 121985 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 81 | 1881829 | 1882065 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 82 | 2304288 | 2304500 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 83 | 4680192 | 4680443 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 84 | 228266 | 228481 | + | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 85 | 1069595 | 1069843 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 86 | 4284399 | 4284617 | - | NZ_LS483422.1 | Providencia heimbachae |
| 87 | 2141726 | 2141935 | - | NZ_AP019827.1 | Leptotrichia shahii |
| 88 | 1361824 | 1362048 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 89 | 2140105 | 2140314 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 90 | 1127467 | 1127718 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 91 | 2684753 | 2684962 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
| 92 | 1041115 | 1041336 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 93 | 791877 | 792098 | + | NZ_CP029736.1 | Providencia rettgeri |
| 94 | 2889204 | 2889449 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 95 | 2099689 | 2099934 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 96 | 1018455 | 1018700 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 97 | 3032184 | 3032429 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 98 | 1914884 | 1915132 | + | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 99 | 2695068 | 2695301 | - | NZ_CP020918.1 | Flavobacterium faecale |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.69 | 68 | 3.0 | same-strand | 60Kd inner membrane protein |
| 2 | PF12631.9 | 0.68 | 67 | 1751 | same-strand | MnmE helical domain |
| 3 | PF10396.11 | 0.68 | 67 | 1751 | same-strand | GTP-binding protein TrmE N-terminus |
++ More..