Result : P29010
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdfD |
| NCBI Accession ID | X07465.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 2213 |
| Right | 2404 |
| Strand | + |
| Nucleotide Sequence | ATGAATTCAGCATTTGTGCTTGTTCTGACAGTTTTTCTTGTTTCCGGAGAGCCAGTTGATATTGCAGTCAGTGTTCACAGGACAATGCAGGAGTGTATGACTGCAGCAACCGAACAGAAAATTCCCGGTAACTGTTACCCGGTCGATAAAGTTATTCACCAGGATAATATCGAAATCCCGGCAGGTCTTTAA |
| Sequence | MNSAFVLVLTVFLVSGEPVDIAVSVHRTMQECMTAATEQKIPGNCYPVDKVIHQDNIEIPAGL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07358. Profile Description: Protein of unknown function (DUF1482). This family consists of several Enterobacterial proteins of around 60 residues in length. The function of this family is unknown. |
| Pubmed ID | 3041373 9097039 9278503 16738553 |
| Domain | CDD:369331 |
| Functional Category | Others |
| Uniprot ID | P29010 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1649794 | 1649985 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2251218 | 2251409 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1761671 | 1761862 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1165170 | 1165361 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1327671 | 1327874 | - | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07151.14 | 1.0 | 2 | 1234 | same-strand | Protein of unknown function (DUF1391) |
| 2 | PF05358.13 | 1.0 | 2 | -3 | same-strand | DicB protein |
| 3 | PF00589.24 | 1.0 | 2 | 2831 | same-strand | Phage integrase family |
| 4 | PF16473.7 | 1.0 | 2 | 93.0 | same-strand | 3' exoribonuclease, RNase T-like |
| 5 | PF06790.13 | 1.0 | 2 | 5193.0 | same-strand | Uncharacterised protein family (UPF0259) |
| 6 | PF03922.16 | 1.0 | 2 | 4019.0 | opposite-strand | OmpW family |
| 7 | PF13505.8 | 1.0 | 2 | 4019.0 | opposite-strand | Outer membrane protein beta-barrel domain |
| 8 | PF09003.12 | 1.0 | 2 | 2843.0 | same-strand | Bacteriophage lambda integrase, Arm DNA-binding domain |
++ More..