| Protein Information | 
| Information Type | Description | 
|---|---|
| Protein name | Tryptophanase operon leader peptide | 
| NCBI Accession ID | M93277.1 | 
| Organism | Proteus vulgaris | 
| Left | 139 | 
| Right | 243 | 
| Strand | + | 
| Nucleotide Sequence | ATGTTCTCATCATTTAATGTATTGATAATATTAAGAGGTTTCGTCAGATTGAAGAAATGGTTTAATATTGACTCTGAACTCGCCTTCTTCTTTCCTAAAAAATAA | 
| Sequence | MFSSFNVLIILRGFVRLKKWFNIDSELAFFFPKK | 
| Source of smORF | Swiss-Prot | 
| Function | The ORF matches to the profile of TIGR02616. Profile Description: tryptophanase leader peptide. Members of this family are the apparent leader peptides of tryptophanase operons in Esherichia coli, Vibrio cholerae, Photobacterium profundum, Haemophilus influenzae type b, and related species. All members of the seed alignment are examples ORFs upstream of tryptophanase, with a start codon, a conserved single Trp residue, and several other conserved residues. It is suggested (Konan KV and Yanofsky C) that the nascent peptide interacts with the ribosome once (if) the ribosome reaches the stop codon. Note that this model describes a much broader set (and shorter protein region) than pfam08053. [Energy metabolism, Amino acids and amines, Transcription, Other] | 
| Pubmed ID | 1400314 | 
| Domain | CDD:274233 | 
| Functional Category | Others | 
| Uniprot ID | P28779 | 
| ORF Length (Amino Acid) | 34 | 
| Conservation Analysis | 
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name | 
|---|---|---|---|---|---|
| 1 | 461717 | 461821 | - | NZ_CP026364.1 | Proteus hauseri | 
| 2 | 2737568 | 2737672 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius | 
| 3 | 3699920 | 3700015 | - | NZ_CP048796.1 | Providencia vermicola | 
| 4 | 1503706 | 1503801 | + | NZ_CP029736.1 | Providencia rettgeri | 
| Neighborhood Conservation Analysis | 
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information | 
|---|---|---|---|---|---|---|
| 1 | PF03222.15 | 1.0 | 4 | 1554.5 | same-strand | Tryptophan/tyrosine permease family | 
| 2 | PF01212.23 | 1.0 | 4 | 103.0 | same-strand | Beta-eliminating lyase |