| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Hydrogenase expression/formation protein HupF |
| NCBI Accession ID | X52974.1 |
| Organism | Rhizobium leguminosarum bv. viciae |
| Left | 5078 |
| Right | 5374 |
| Strand | + |
| Nucleotide Sequence | ATGTGCATCGGCATTCCCATGCGGGTCGTCGTCGGCAGCGAGTTCATCGCGCAATGCGAGCGCCATGGCGCGATCTCCTCGATTTCCCTGATGCTGGTCGGCCCGCAGGCGCCCGGAACCCATCTGCTCACCCATCTCGGCTCGGCCATCCGCGTGCTCGATGCCGACGAGGCCCGCGCAATCGACGACGCGCTCGCCGGACTTGCCGAAGCGGTGGAGGGAAGAGCCTTCGATATGCTCTTCGCCGATCTCATTTCCCGCGAGCCGGAATTGCCGCCGCATTTGCGCGGCGAGTGA |
| Sequence | MCIGIPMRVVVGSEFIAQCERHGAISSISLMLVGPQAPGTHLLTHLGSAIRVLDADEARAIDDALAGLAEAVEGRAFDMLFADLISREPELPPHLRGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00394. Profile Description: HupF/HypC family. This protein is suggested by act as a chaperone for a hydrogenase large subunit, holding the precursor form before metallocenter nickel incorporation. [SS 12/31/03] More recently proposed additional function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. . Added metallochaperone and protein mod GO terms. [Protein fate, Protein folding and stabilization, Protein fate, Protein modification and repair] |
| Pubmed ID | 1597428 |
| Domain | CDD:412356 |
| Functional Category | Others |
| Uniprot ID | P27651 |
| ORF Length (Amino Acid) | 98 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 215642 | 215938 | + | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 2 | 523741 | 524037 | + | NZ_CP050299.1 | Mesorhizobium huakuii |
| 3 | 111368 | 111664 | + | NZ_CP041240.1 | Ensifer mexicanus |
| 4 | 427718 | 428014 | - | NZ_CP013109.1 | Sinorhizobium americanum |
| 5 | 461027 | 461323 | - | NZ_CP020910.1 | Rhizobium etli |
| 6 | 180604 | 180900 | + | NZ_CP015322.1 | Mesorhizobium amorphae CCNWGS0123 |
| 7 | 126964 | 127260 | - | NZ_CP032696.1 | Rhizobium jaguaris |
| 8 | 165984 | 166298 | - | NC_020061.1 | Rhizobium tropici CIAT 899 |
| 9 | 1813748 | 1814038 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 10 | 2943649 | 2943969 | + | NZ_AP018907.1 | Blastochloris tepida |
| 11 | 2815188 | 2815517 | - | NZ_CP012946.1 | Blastochloris viridis |
| 12 | 222347 | 222643 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 13 | 1053821 | 1054123 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 14 | 2761287 | 2761589 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 15 | 960804 | 961103 | + | NZ_CP044331.1 | Methylocystis parvus |
| 16 | 1942868 | 1943164 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 17 | 1001616 | 1001942 | - | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 18 | 1490999 | 1491304 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14720.8 | 0.94 | 17 | 3395 | same-strand | NiFe/NiFeSe hydrogenase small subunit C-terminal |
| 2 | PF01058.24 | 0.94 | 17 | 3395 | same-strand | NADH ubiquinone oxidoreductase, 20 Kd subunit |
| 3 | PF00374.21 | 0.94 | 17 | 1562 | same-strand | Nickel-dependent hydrogenase |
| 4 | PF01292.22 | 1.0 | 18 | 799.5 | same-strand | Prokaryotic cytochrome b561 |
| 5 | PF14358.8 | 1.0 | 18 | 799.5 | same-strand | Domain of unknown function (DUF4405) |
| 6 | PF01750.20 | 1.0 | 18 | 196.0 | same-strand | Hydrogenase maturation protease |
| 7 | PF07449.13 | 0.67 | 12 | 164.5 | same-strand | Hydrogenase-1 expression protein HyaE |
| 8 | PF04809.15 | 0.89 | 16 | 610.5 | same-strand | HupH hydrogenase expression protein, C-terminal conserved region |
| 9 | PF00301.22 | 0.61 | 11 | 1460 | same-strand | Rubredoxin |
| 10 | PF11939.10 | 0.78 | 14 | 1558.0 | same-strand | [NiFe]-hydrogenase assembly, chaperone, HybE |