Protein Information |
Information Type | Description |
---|---|
Protein name | Protein TraD |
NCBI Accession ID | X59793.1 |
Organism | Escherichia coli |
Left | 116 |
Right | 379 |
Strand | + |
Nucleotide Sequence | ATGAATGATCCCAAGACCGTGCAGCAGGACGACTTTGCGCCGTTCGACGATACCGCGAACGCCGCCGCCGCCCTGCGTGAAAAGCTCGCCGATGCGATGACGCCCGGCTTCCAGGTCGAGTTCGACCCGGAAGAAGCGGAGAAGGCCGGGGCCTTCCCCGAGGACGCCTTGAGCGAGCAGGACGCCGCCGAGAGCGACATTGACCTGGTGGACGCGACCGTGCCCGAGGACACGACGACCGCGGCCGCCAATGACGGGAGGTAA |
Sequence | MNDPKTVQQDDFAPFDDTANAAAALREKLADAMTPGFQVEFDPEEAEKAGAFPEDALSEQDAAESDIDLVDATVPEDTTTAAANDGR |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 1818755 |
Domain | |
Functional Category | Others |
Uniprot ID | P27193 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 21708 | 21950 | + | NC_017508.1 | Marinobacter adhaerens HP15 |
2 | 31679 | 31921 | - | NC_017858.1 | Methylophaga frappieri |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03432.16 | 1.0 | 2 | 4522.5 | same-strand | Relaxase/Mobilisation nuclease domain |
2 | PF18821.3 | 1.0 | 2 | 4522.5 | same-strand | Large polyvalent protein-associated domain 7 |
3 | PF02534.16 | 1.0 | 2 | 2618.5 | same-strand | Type IV secretory system Conjugative DNA transfer |
4 | PF12696.9 | 1.0 | 2 | 2618.5 | same-strand | TraM recognition site of TraD and TraG |
5 | PF10412.11 | 1.0 | 2 | 2618.5 | same-strand | Type IV secretion-system coupling protein DNA-binding domain |
6 | PF10502.11 | 1.0 | 2 | 2085.5 | same-strand | Signal peptidase, peptidase S26 |
7 | PF01131.22 | 1.0 | 2 | 6.0 | same-strand | DNA topoisomerase |
8 | PF01751.24 | 1.0 | 2 | 6.0 | same-strand | Toprim domain |
9 | PF01396.21 | 1.0 | 2 | 6.0 | same-strand | Topoisomerase DNA binding C4 zinc finger |
10 | PF18818.3 | 1.0 | 2 | 4.0 | same-strand | Zincin-like metallopeptidase |
11 | PF18974.2 | 1.0 | 2 | 4.0 | same-strand | Domain of unknown function (DUF5710) |
12 | PF08401.13 | 1.0 | 2 | 4.0 | same-strand | N-terminal domain of anti-restriction factor ArdC |
13 | PF00929.26 | 1.0 | 2 | 3425.5 | opposite-strand | Exonuclease |