Result : P27193
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein TraD |
| NCBI Accession ID | X59793.1 |
| Organism | Escherichia coli |
| Left | 116 |
| Right | 379 |
| Strand | + |
| Nucleotide Sequence | ATGAATGATCCCAAGACCGTGCAGCAGGACGACTTTGCGCCGTTCGACGATACCGCGAACGCCGCCGCCGCCCTGCGTGAAAAGCTCGCCGATGCGATGACGCCCGGCTTCCAGGTCGAGTTCGACCCGGAAGAAGCGGAGAAGGCCGGGGCCTTCCCCGAGGACGCCTTGAGCGAGCAGGACGCCGCCGAGAGCGACATTGACCTGGTGGACGCGACCGTGCCCGAGGACACGACGACCGCGGCCGCCAATGACGGGAGGTAA |
| Sequence | MNDPKTVQQDDFAPFDDTANAAAALREKLADAMTPGFQVEFDPEEAEKAGAFPEDALSEQDAAESDIDLVDATVPEDTTTAAANDGR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 1818755 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P27193 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 21708 | 21950 | + | NC_017508.1 | Marinobacter adhaerens HP15 |
| 2 | 31679 | 31921 | - | NC_017858.1 | Methylophaga frappieri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017508.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03432.16 | 1.0 | 2 | 4522.5 | same-strand | Relaxase/Mobilisation nuclease domain |
| 2 | PF18821.3 | 1.0 | 2 | 4522.5 | same-strand | Large polyvalent protein-associated domain 7 |
| 3 | PF02534.16 | 1.0 | 2 | 2618.5 | same-strand | Type IV secretory system Conjugative DNA transfer |
| 4 | PF12696.9 | 1.0 | 2 | 2618.5 | same-strand | TraM recognition site of TraD and TraG |
| 5 | PF10412.11 | 1.0 | 2 | 2618.5 | same-strand | Type IV secretion-system coupling protein DNA-binding domain |
| 6 | PF10502.11 | 1.0 | 2 | 2085.5 | same-strand | Signal peptidase, peptidase S26 |
| 7 | PF01131.22 | 1.0 | 2 | 6.0 | same-strand | DNA topoisomerase |
| 8 | PF01751.24 | 1.0 | 2 | 6.0 | same-strand | Toprim domain |
| 9 | PF01396.21 | 1.0 | 2 | 6.0 | same-strand | Topoisomerase DNA binding C4 zinc finger |
| 10 | PF18818.3 | 1.0 | 2 | 4.0 | same-strand | Zincin-like metallopeptidase |
| 11 | PF18974.2 | 1.0 | 2 | 4.0 | same-strand | Domain of unknown function (DUF5710) |
| 12 | PF08401.13 | 1.0 | 2 | 4.0 | same-strand | N-terminal domain of anti-restriction factor ArdC |
| 13 | PF00929.26 | 1.0 | 2 | 3425.5 | opposite-strand | Exonuclease |
++ More..