Result : A0A385XJK5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YpaB |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2344594 |
| Right | 2344737 |
| Strand | - |
| Nucleotide Sequence | ATGACCCTCTTGCAAGTGCATAACTTTGTGGATAACTCAGGAAGGAAAAAGTGGCTTTCGCGCACCTTAGGTCAGACAAGGTGTCCGGGAAAGTCAATGGGAAGAGAAAAATTTGTTAAAAATAACTGTTCGGCGATTTCTTGA |
| Sequence | MTLLQVHNFVDNSGRKKWLSRTLGQTRCPGKSMGREKFVKNNCSAIS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A0A385XJK5 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2344594 | 2344737 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2361347 | 2361490 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1376429 | 1376572 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3070512 | 3070655 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 4450991 | 4451134 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 2887060 | 2887203 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00521.22 | 0.8 | 4 | 5187 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
| 2 | PF03989.15 | 0.8 | 4 | 5187 | same-strand | DNA gyrase C-terminal domain, beta-propeller |
| 3 | PF08241.14 | 1.0 | 5 | 4318.0 | opposite-strand | Methyltransferase domain |
| 4 | PF13649.8 | 1.0 | 5 | 4318.0 | opposite-strand | Methyltransferase domain |
| 5 | PF08242.14 | 1.0 | 5 | 4318.0 | opposite-strand | Methyltransferase domain |
| 6 | PF03797.21 | 1.0 | 5 | 449.0 | same-strand | Autotransporter beta-domain |
| 7 | PF18883.2 | 1.0 | 5 | 449.0 | same-strand | Autochaperone Domain Type 1 |
| 8 | PF12951.9 | 0.8 | 4 | 1226 | same-strand | Passenger-associated-transport-repeat |
| 9 | PF02867.17 | 1.0 | 5 | 128.0 | opposite-strand | Ribonucleotide reductase, barrel domain |
| 10 | PF03477.18 | 1.0 | 5 | 128.0 | opposite-strand | ATP cone domain |
| 11 | PF00317.23 | 1.0 | 5 | 128.0 | opposite-strand | Ribonucleotide reductase, all-alpha domain |
| 12 | PF00268.23 | 1.0 | 5 | 2599.5 | opposite-strand | Ribonucleotide reductase, small chain |
| 13 | PF00111.29 | 1.0 | 5 | 3729.5 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 14 | PF06293.16 | 1.0 | 5 | 4047.0 | same-strand | Lipopolysaccharide kinase (Kdo/WaaP) family |
++ More..