Result : P26910
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ferredoxin soy |
| NCBI Accession ID | X63601.1 |
| Organism | Streptomyces griseus |
| Left | 1393 |
| Right | 1590 |
| Strand | + |
| Nucleotide Sequence | GTGGGAGTCCAGGTCGACAAGGAACGCTGTGTGGGCGCCGGCATGTGTGCGCTGACCGCGCCGGACGTCTTCACCCAGGACGACGACGGTCTCAGCGAGGTGCTCCCCGGCCGGGAGGCGACGTCCGGGACCCATCCGCTGGTGGGGGAGGCGGTACGGGCCTGCCCGGTGGGGGCGGTGGTCCTCTCCTCCGACTGA |
| Sequence | MGVQVDKERCVGAGMCALTAPDVFTQDDDGLSEVLPGREATSGTHPLVGEAVRACPVGAVVLSSD |
| Source of smORF | Swiss-Prot |
| Function | Electron transport protein for the cytochrome P-450-SOY system. |
| Pubmed ID | 1406253 |
| Domain | CDD:418523 |
| Functional Category | Metal-binding |
| Uniprot ID | P26910 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 25577 | 25774 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 2 | 268554 | 268745 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 3 | 280898 | 281095 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 4 | 7531265 | 7531462 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 5 | 7729963 | 7730130 | + | NZ_CP070242.1 | Streptomyces californicus |
| 6 | 2195275 | 2195478 | + | NZ_CP070242.1 | Streptomyces californicus |
| 7 | 7833843 | 7834010 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 8 | 2182359 | 2182562 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 9 | 7427724 | 7427918 | - | NZ_CP022685.1 | Streptomyces formicae |
| 10 | 2268116 | 2268310 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 11 | 7292963 | 7293163 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 12 | 7440875 | 7441069 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 13 | 7534185 | 7534370 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 14 | 8565458 | 8565658 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 15 | 56583 | 56777 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 16 | 6510698 | 6510859 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 17 | 6634127 | 6634327 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 18 | 7186302 | 7186496 | - | NZ_CP023691.1 | Streptomyces platensis |
| 19 | 688331 | 688531 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 20 | 8388066 | 8388272 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 21 | 1241288 | 1241509 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 22 | 4976306 | 4976500 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 23 | 4118882 | 4119082 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 24 | 2818936 | 2819127 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 25 | 808259 | 808489 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 26 | 6786066 | 6786275 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 27 | 809453 | 809662 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 28 | 8897210 | 8897401 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 29 | 9638014 | 9638208 | + | NZ_CP070326.1 | Streptomyces noursei |
| 30 | 559220 | 559420 | - | NZ_CP070326.1 | Streptomyces noursei |
| 31 | 8241989 | 8242186 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 32 | 6706764 | 6706967 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 33 | 9033882 | 9034070 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 34 | 900670 | 900870 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 35 | 8598308 | 8598505 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 36 | 460331 | 460528 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 37 | 6644985 | 6645188 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 38 | 1870281 | 1870472 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 39 | 1724399 | 1724593 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 40 | 169924 | 170115 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 41 | 9434517 | 9434711 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 42 | 277747 | 277935 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 43 | 6028911 | 6029111 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 44 | 3145226 | 3145414 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 45 | 8662680 | 8662889 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 46 | 7515643 | 7515852 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 47 | 9220084 | 9220284 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 48 | 7359905 | 7360099 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 49 | 1108192 | 1108392 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 50 | 701351 | 701542 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 51 | 888380 | 888571 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 52 | 8604938 | 8605144 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 53 | 7019891 | 7020085 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 54 | 754185 | 754355 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 55 | 1860291 | 1860491 | - | NZ_CP030862.1 | Streptomyces globosus |
| 56 | 6601979 | 6602170 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 57 | 8321402 | 8321590 | + | NZ_CP027306.1 | Streptomyces atratus |
| 58 | 7976952 | 7977152 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 59 | 7758150 | 7758344 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 60 | 4066522 | 4066710 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 61 | 4233637 | 4233825 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 62 | 1219014 | 1219205 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 63 | 5237567 | 5237737 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 64 | 5326678 | 5326869 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 65 | 1455139 | 1455330 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 66 | 2393925 | 2394110 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 67 | 4661587 | 4661769 | + | NZ_AP023396.1 | Nocardia wallacei |
| 68 | 1441483 | 1441680 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 69 | 4723812 | 4724006 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 70 | 4461987 | 4462160 | + | NZ_CP022310.1 | Streptomyces calvus |
| 71 | 8679540 | 8679710 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 72 | 2913024 | 2913218 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 73 | 1921351 | 1921545 | + | NZ_CP016353.1 | Prauserella marina |
++ More..