Result : P26800
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 11.4 kDa protein (ORF1) |
| NCBI Accession ID | X64391.1 |
| Organism | Streptomyces fradiae (Streptomyces roseoflavus) |
| Left | 133 |
| Right | 432 |
| Strand | + |
| Nucleotide Sequence | GTGAAGGCGACGAGGCGGACGCGGGTCGCGTCGGAACGGGGGGTGAGACGCAGGAGACGGGTCAGGGCCACCAGGAAGGCCGGGGAGCTGCCGGTGAAGGTGTGGGCGCGCACATTGCCTTCGGCGGCGTGGGATCCGGTGGGGTCGGTGCGTACCCAGGTGACGCCGTCGAGGGCGGCGCCGCGTACCTGCCAGCCGCCGGCGTGGAGTTCGAGGCGGAGGGGGCGGCCGAGGTCGTCGAGGGCGAGGTCGACGGAGCCGGCGTGGTCGCCGGAGGGGGTGGTGCGTTGCGCGACGTAG |
| Sequence | MKATRRTRVASERGVRRRRRVRATRKAGELPVKVWARTLPSAAWDPVGSVRTQVTPSRAAPRTCQPPAWSSRRRGRPRSSRARSTEPAWSPEGVVRCAT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 1614864 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P26800 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2521636 | 2521935 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 2 | 2377475 | 2377774 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 3 | 3652781 | 3653080 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 4 | 2302885 | 2303184 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 5 | 5750795 | 5751094 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 6 | 2876525 | 2876824 | + | NZ_CP070242.1 | Streptomyces californicus |
| 7 | 5203046 | 5203345 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 8 | 5284738 | 5285037 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 9 | 1998503 | 1998802 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 10 | 2851944 | 2852234 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 11 | 3263656 | 3263922 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 12 | 4699472 | 4699738 | - | NZ_CP022310.1 | Streptomyces calvus |
| 13 | 3571228 | 3571527 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 14 | 7391525 | 7391824 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 15 | 2591116 | 2591433 | + | NZ_CP031194.1 | Streptomyces paludis |
| 16 | 2928209 | 2928475 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 17 | 2876327 | 2876584 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 18 | 4144137 | 4144436 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 19 | 2888398 | 2888697 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 20 | 4062270 | 4062569 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 21 | 5910629 | 5910928 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 22 | 5250814 | 5251110 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 23 | 5236492 | 5236791 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 24 | 3342308 | 3342607 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 25 | 5690971 | 5691237 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 26 | 3826516 | 3826782 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 27 | 3019974 | 3020273 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 28 | 3044692 | 3044991 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 29 | 4494523 | 4494789 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 30 | 2970895 | 2971194 | + | NZ_CP029043.1 | Streptomyces nigra |
| 31 | 3951987 | 3952286 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 32 | 2774803 | 2775102 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 33 | 4368817 | 4369083 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 34 | 6138318 | 6138584 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 35 | 5224157 | 5224456 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 36 | 3128224 | 3128523 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 37 | 3517659 | 3517958 | + | NZ_CP023691.1 | Streptomyces platensis |
| 38 | 4231471 | 4231770 | + | NZ_CP070326.1 | Streptomyces noursei |
| 39 | 3179464 | 3179730 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 40 | 3440517 | 3440816 | + | NZ_CP019457.1 | Streptomyces lydicus |
| 41 | 5585112 | 5585411 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 42 | 2146842 | 2147141 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 43 | 3852704 | 3853003 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 44 | 3085356 | 3085622 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 45 | 4623551 | 4623850 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 46 | 4426313 | 4426636 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 47 | 4246474 | 4246740 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 48 | 3633629 | 3633895 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 49 | 5679231 | 5679530 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 50 | 3251639 | 3251938 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 51 | 3050993 | 3051292 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 52 | 2252147 | 2252452 | + | NC_020990.1 | Streptomyces albidoflavus |
| 53 | 2403110 | 2403409 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 54 | 2680891 | 2681196 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 55 | 4177575 | 4177874 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 56 | 3798511 | 3798810 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 57 | 3560014 | 3560280 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 58 | 4709900 | 4710190 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 59 | 2586549 | 2586848 | + | NZ_CP054938.1 | Streptomyces harbinensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01882.20 | 0.88 | 52 | 8240.5 | same-strand | Protein of unknown function DUF58 |
| 2 | PF01944.19 | 0.93 | 55 | 1380 | opposite-strand | Stage II sporulation protein M |
| 3 | PF06271.14 | 0.92 | 54 | 262.5 | same-strand | RDD family |
| 4 | PF05221.19 | 1.0 | 59 | 264 | opposite-strand | S-adenosyl-L-homocysteine hydrolase |
| 5 | PF00670.23 | 1.0 | 59 | 264 | opposite-strand | S-adenosyl-L-homocysteine hydrolase, NAD binding domain |
| 6 | PF01545.23 | 0.95 | 56 | 2094.0 | opposite-strand | Cation efflux family |
| 7 | PF01238.23 | 0.93 | 55 | 3204 | opposite-strand | Phosphomannose isomerase type I |
| 8 | PF10432.11 | 0.83 | 49 | 4513 | opposite-strand | Bacterial phospho-glucose isomerase C-terminal SIS domain |
| 9 | PF07726.13 | 0.68 | 40 | 9542.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 10 | PF17863.3 | 0.68 | 40 | 9542.5 | same-strand | AAA lid domain |
| 11 | PF07728.16 | 0.68 | 40 | 9542.5 | same-strand | AAA domain (dynein-related subfamily) |
| 12 | PF20030.1 | 0.68 | 40 | 9542.5 | same-strand | MoxR domain in the MoxR-vWA-beta-propeller ternary systems |
++ More..