Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0437 protein AZC_3451 (ORF1) |
NCBI Accession ID | X55450.1 |
Organism | Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) |
Left | 3832 |
Right | 4041 |
Strand | + |
Nucleotide Sequence | ATGTCCGACATCGAGACCCTCAAGGCCGAGATCAAGAAGCTCTCTGCCAAGTCGGTGAATGCCAAGATGAACCTGCACGACCTCTCCGAGGACCTGCCCACCAATTGGCAGAGCATCCTCGAGGTGGCGCAGGAGACCTACAACACCTTCAAGACGCTGGAAGACGCCCGCAAGAAGCTCAAGGAACTGGAAGCCGGTGCCGCGGCCTGA |
Sequence | MSDIETLKAEIKKLSAKSVNAKMNLHDLSEDLPTNWQSILEVAQETYNTFKTLEDARKKLKELEAGAAA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl02247. Profile Description: Rop-like. This family contains several uncharacterized bacterial proteins. These proteins are found in nitrogen fixation operons so are likely to play some role in this process. They consist of two alpha helices which are joined by a four residue linker. The helices form an antiparallel bundle and cross towards their termini. They are likely to form a rod-like dimer. They have structural similarity to the regulatory protein Rop, pfam01815. |
Pubmed ID | 1850088 |
Domain | CDD:413246 |
Functional Category | Others |
Uniprot ID | P26486 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3966317 | 3966526 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
2 | 5059980 | 5060186 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
3 | 4413473 | 4413673 | - | NZ_CP046052.1 | Methylocystis heyeri |
4 | 1834733 | 1834933 | - | NZ_CP044331.1 | Methylocystis parvus |
5 | 4003935 | 4004135 | + | NZ_CP044331.1 | Methylocystis parvus |
6 | 331866 | 332069 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
7 | 1709436 | 1709636 | - | NZ_CP019948.1 | Methylocystis bryophila |
8 | 192096 | 192296 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
9 | 3989275 | 3989475 | - | NC_011666.1 | Methylocella silvestris BL2 |
10 | 5579916 | 5580116 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
11 | 123467 | 123667 | + | NZ_CP012401.1 | Azospirillum thiophilum |
12 | 544080 | 544280 | - | NZ_CP029829.1 | Azospirillum ramasamyi |
13 | 2603203 | 2603403 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
14 | 1157183 | 1157416 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
15 | 2297540 | 2297740 | + | NZ_CP054619.1 | Azospirillum oryzae |
16 | 1810881 | 1811081 | + | NZ_CP029353.1 | Azospirillum thermophilum |
17 | 4709517 | 4709717 | - | NC_017082.1 | Bradyrhizobium cosmicum |
18 | 2141883 | 2142083 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
19 | 5734407 | 5734607 | - | NZ_CP016428.1 | Bradyrhizobium icense |
20 | 5421737 | 5421937 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
21 | 542480 | 542680 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
22 | 1439629 | 1439829 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
23 | 1686982 | 1687182 | + | NZ_CP025086.1 | Methylovirgula ligni |
24 | 1707051 | 1707251 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
25 | 3698869 | 3699066 | - | NZ_CP030265.1 | Skermanella pratensis |
26 | 2132305 | 2132505 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
27 | 1906147 | 1906344 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
28 | 7137311 | 7137511 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
29 | 2910941 | 2911144 | - | NZ_CP022423.1 | Vitreoscilla filiformis |
30 | 1637226 | 1637408 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
31 | 942532 | 942720 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
32 | 245757 | 245936 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
33 | 409265 | 409462 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
34 | 2456711 | 2456911 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
35 | 565552 | 565746 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
36 | 5868431 | 5868619 | + | NZ_AP017928.1 | Methylocaldum marinum |
37 | 503764 | 503982 | + | NC_010627.1 | Paraburkholderia phymatum STM815 |
38 | 2260298 | 2260480 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12838.9 | 0.95 | 35 | 19.0 | same-strand | 4Fe-4S dicluster domain |
2 | PF14697.8 | 0.92 | 34 | 17.0 | same-strand | 4Fe-4S dicluster domain |
3 | PF13187.8 | 0.92 | 34 | 17.0 | same-strand | 4Fe-4S dicluster domain |
4 | PF13484.8 | 0.92 | 34 | 17.0 | same-strand | 4Fe-4S double cluster binding domain |
5 | PF13237.8 | 0.89 | 33 | 19.0 | same-strand | 4Fe-4S dicluster domain |
6 | PF13183.8 | 0.92 | 34 | 18 | same-strand | 4Fe-4S dicluster domain |
7 | PF03270.15 | 0.92 | 34 | 15.0 | same-strand | Protein of unknown function, DUF269 |
8 | PF02579.19 | 0.95 | 35 | 492 | same-strand | Dinitrogenase iron-molybdenum cofactor |
9 | PF00148.21 | 0.95 | 35 | 2296 | same-strand | Nitrogenase component 1 type Oxidoreductase |
10 | PF00037.29 | 0.68 | 25 | 18 | same-strand | 4Fe-4S binding domain |