Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-870 beta chain (Antenna pigment protein beta chain) |
NCBI Accession ID | X57597.1 |
Organism | Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) |
Left | 540 |
Right | 692 |
Strand | + |
Nucleotide Sequence | ATGGCTGATAATACCGACCTGTCCTTCACAGGTCTTACAGACGAACAGGCGCAAGAATTGCATTCTGTCTACATGAGCGGGCTTTTCCTGTTCGCGGCAGTTGCTGTGGTCGCTCACTTGGCGACTTACATCTGGCGTCCGTGGTTCGGTTAA |
Sequence | MADNTDLSFTGLTDEQAQELHSVYMSGLFLFAAVAVVAHLATYIWRPWFG |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 1787796 17098896 |
Domain | |
Functional Category | Metal-binding |
Uniprot ID | P26274 |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2262776 | 2262928 | - | NZ_CP027407.1 | Roseobacter denitrificans |
2 | 21132 | 21284 | + | NC_015741.1 | Roseobacter litoralis Och 149 |
3 | 2549686 | 2549835 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
4 | 1072096 | 1072245 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
5 | 21167 | 21316 | + | NZ_CP048789.1 | Roseobacter ponti |
6 | 646123 | 646272 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
7 | 3701410 | 3701559 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
8 | 1044244 | 1044393 | + | NZ_CP034348.1 | Roseovarius faecimaris |
9 | 3908053 | 3908202 | + | NZ_CP034328.1 | Tabrizicola piscis |
10 | 46865 | 47014 | + | NZ_CP020470.1 | Rhodobacter blasticus |
11 | 784229 | 784378 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
12 | 3138087 | 3138242 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
13 | 860675 | 860806 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
14 | 371788 | 371934 | + | NZ_CP023276.1 | Polynucleobacter difficilis |
15 | 1318891 | 1319037 | - | NZ_CP007501.1 | Polynucleobacter duraquae |
16 | 3017259 | 3017402 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
17 | 1236485 | 1236628 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13292.8 | 0.76 | 13 | 3405 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
2 | PF02779.26 | 0.76 | 13 | 3405 | same-strand | Transketolase, pyrimidine binding domain |
3 | PF02780.22 | 0.76 | 13 | 3405 | same-strand | Transketolase, C-terminal domain |
4 | PF02276.20 | 0.65 | 11 | 2248 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
5 | PF00124.21 | 0.94 | 16 | 857.0 | same-strand | Photosynthetic reaction centre protein |
6 | PF00556.22 | 1.0 | 17 | 15.5 | same-strand | Antenna complex alpha/beta subunit |
7 | PF05398.13 | 0.76 | 13 | 157 | same-strand | PufQ cytochrome subunit |
8 | PF00148.21 | 0.94 | 16 | 1581 | same-strand | Nitrogenase component 1 type Oxidoreductase |
9 | PF08369.12 | 0.94 | 16 | 372.0 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
10 | PF00142.20 | 0.94 | 16 | 3482.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
11 | PF01656.25 | 0.94 | 16 | 3482.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |