Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-870 alpha chain (Antenna pigment protein alpha chain) |
NCBI Accession ID | X57597.1 |
Organism | Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) |
Left | 705 |
Right | 863 |
Strand | + |
Nucleotide Sequence | ATGGCAAAGTTCTATAAGATCTGGCTGATCTTCGACCCCCGTCGCGTTTTCGTGGCGCAGGGCGTGTTTCTCTTCCTTTTGGCGGCGATGATCCACCTGGTGGTGCTCAGCAGCGGCCTGAACTGGTTCGAGGCGGCAGCCGCCGTCGGAGGTCAGTAA |
Sequence | MAKFYKIWLIFDPRRVFVAQGVFLFLLAAMIHLVVLSSGLNWFEAAAAVGGQ |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 1787796 17098896 |
Domain | CDD:395441 |
Functional Category | Metal-binding |
Uniprot ID | P26273 |
ORF Length (Amino Acid) | 52 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2262605 | 2262763 | - | NZ_CP027407.1 | Roseobacter denitrificans |
2 | 21297 | 21455 | + | NC_015741.1 | Roseobacter litoralis Och 149 |
3 | 2549513 | 2549671 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
4 | 646286 | 646447 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
5 | 1072261 | 1072425 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
6 | 21328 | 21486 | + | NZ_CP048789.1 | Roseobacter ponti |
7 | 3701573 | 3701734 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
8 | 3138259 | 3138411 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
9 | 784392 | 784568 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
10 | 47028 | 47216 | + | NZ_CP020470.1 | Rhodobacter blasticus |
11 | 2173748 | 2173882 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
12 | 6685152 | 6685337 | - | NZ_CP029550.1 | Methylobacterium durans |
13 | 2991163 | 2991297 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
14 | 2881060 | 2881194 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13292.8 | 0.71 | 10 | 3294.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
2 | PF02779.26 | 0.71 | 10 | 3294.0 | same-strand | Transketolase, pyrimidine binding domain |
3 | PF02780.22 | 0.71 | 10 | 3294.0 | same-strand | Transketolase, C-terminal domain |
4 | PF02276.20 | 0.71 | 10 | 2064.0 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
5 | PF00124.21 | 1.0 | 14 | 975.5 | same-strand | Photosynthetic reaction centre protein |
6 | PF00556.22 | 1.0 | 14 | 49.5 | same-strand | Antenna complex alpha/beta subunit |
7 | PF05398.13 | 0.71 | 10 | 333.5 | same-strand | PufQ cytochrome subunit |
8 | PF00148.21 | 0.79 | 11 | 1338.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
9 | PF08369.12 | 0.79 | 11 | 584 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |