Result : P25966
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | M84712.1 |
| Organism | Alkalihalobacillus alcalophilus (Bacillus alcalophilus) |
| Left | 308 |
| Right | 523 |
| Strand | + |
| Nucleotide Sequence | ATGGGTTTATTAGGAGCAGCAATTGTTGCAGGTTTAGCAGCTGTCGGAGGAGCAATCGCCGTAGCTATCATTGTAAAATCAACTATCGAGGGAGTAACTCGTCAACCAGAACTTAAAGGTACATTACAAACACTTATGTTCATCGGGGTACCTCTTGCAGAAGCCGTACCAATCATCGCGATCGTTATGGGCTTCCTAATCATGGGTAACGCTTAA |
| Sequence | MGLLGAAIVAGLAAVGGAIAVAIIVKSTIEGVTRQPELKGTLQTLMFIGVPLAEAVPIIAIVMGFLIMGNA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 1448623 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | P25966 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 93
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 192626 | 192808 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 2 | 6363324 | 6363548 | - | NZ_AP019400.1 | Cohnella abietis |
| 3 | 3889113 | 3889331 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 4 | 108283 | 108501 | + | NZ_CP040336.1 | Bacillus luti |
| 5 | 5043350 | 5043568 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 6 | 5064199 | 5064417 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 7 | 5229627 | 5229845 | - | NC_011725.1 | Bacillus cereus B4264 |
| 8 | 5267343 | 5267561 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 9 | 4893383 | 4893595 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 10 | 3061902 | 3062126 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 11 | 240037 | 240252 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 12 | 4102697 | 4102912 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 13 | 911851 | 912087 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 14 | 1007331 | 1007543 | + | NZ_CP026363.1 | Brevibacillus agri |
| 15 | 2283167 | 2283358 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 16 | 1607928 | 1608140 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 17 | 1676101 | 1676313 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 18 | 2365379 | 2365591 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 19 | 6115560 | 6115745 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 20 | 708338 | 708550 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 21 | 956564 | 956776 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 22 | 870320 | 870532 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 23 | 51585 | 51797 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 24 | 891148 | 891384 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 25 | 1858784 | 1858996 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 26 | 4026833 | 4027048 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 27 | 5854257 | 5854472 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 28 | 574229 | 574450 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 29 | 3260481 | 3260654 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 30 | 3303828 | 3304001 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 31 | 2470173 | 2470385 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 32 | 105949 | 106161 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 33 | 819890 | 820102 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 34 | 1325348 | 1325560 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 35 | 860725 | 860937 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 36 | 609125 | 609337 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 37 | 897916 | 898128 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 38 | 2041914 | 2042126 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 39 | 2128112 | 2128324 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 40 | 2172982 | 2173194 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 41 | 6516161 | 6516385 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 42 | 839239 | 839445 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 43 | 1873328 | 1873534 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 44 | 833017 | 833232 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 45 | 3536505 | 3536717 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 46 | 1007282 | 1007491 | + | NZ_CP031423.1 | Microbacterium lemovicicum |
| 47 | 4681534 | 4681719 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 48 | 3420997 | 3421203 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 49 | 2225994 | 2226203 | - | NZ_CP044231.1 | Microbacterium caowuchunii |
| 50 | 1668694 | 1668906 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 51 | 896533 | 896739 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 52 | 952430 | 952615 | + | NZ_CP064760.1 | Microbacterium schleiferi |
| 53 | 2774033 | 2774257 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 54 | 2284398 | 2284613 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 55 | 745608 | 745832 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 56 | 804662 | 804886 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 57 | 380075 | 380287 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 58 | 1145478 | 1145693 | - | NZ_CP021434.1 | Tumebacillus avium |
| 59 | 212410 | 212622 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 60 | 1458665 | 1458901 | + | NZ_CP031425.1 | Microbacterium foliorum |
| 61 | 183975 | 184160 | - | NZ_CP061344.1 | Microbacterium hominis |
| 62 | 3404617 | 3404829 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 63 | 2566865 | 2567077 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 64 | 413427 | 413639 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 65 | 2535035 | 2535247 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 66 | 3761540 | 3761737 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 67 | 2188514 | 2188756 | - | NZ_CP071883.1 | Curtobacterium flaccumfaciens pv. flaccumfaciens |
| 68 | 6610203 | 6610403 | - | NZ_AP023396.1 | Nocardia wallacei |
| 69 | 2499745 | 2499963 | - | NZ_LR134483.1 | Listeria grayi |
| 70 | 1403822 | 1404037 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 71 | 6645154 | 6645369 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 72 | 1375890 | 1376105 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 73 | 7365336 | 7365554 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 74 | 2521205 | 2521423 | - | NZ_LT906444.1 | Listeria welshimeri |
| 75 | 1143841 | 1144068 | - | NZ_CP049863.1 | Leucobacter viscericola |
| 76 | 5966374 | 5966586 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 77 | 3824957 | 3825172 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 78 | 1393919 | 1394143 | - | NZ_CP026923.1 | Pontimonas salivibrio |
| 79 | 3734518 | 3734730 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 80 | 4895827 | 4896018 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 81 | 6393183 | 6393395 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 82 | 2294169 | 2294402 | + | NZ_CP049253.1 | Microbacterium amylolyticum |
| 83 | 2164726 | 2164926 | - | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 84 | 522459 | 522686 | - | NC_004572.3 | Tropheryma whipplei str. Twist |
| 85 | 3871792 | 3871992 | - | NZ_CP033433.1 | Cohnella candidum |
| 86 | 3280863 | 3281120 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 87 | 2860425 | 2860628 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 88 | 1458393 | 1458650 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 89 | 3293274 | 3293531 | - | NC_011753.2 | Vibrio atlanticus |
| 90 | 3322894 | 3323151 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 91 | 3434408 | 3434665 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 92 | 375883 | 376074 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 93 | 1589414 | 1589635 | + | NZ_CP023564.1 | Brachybacterium ginsengisoli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012502.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14681.8 | 0.6 | 56 | 2469.0 | same-strand | Uracil phosphoribosyltransferase |
| 2 | PF03899.17 | 0.76 | 71 | 809 | same-strand | ATP synthase I chain |
| 3 | PF00119.22 | 1.0 | 93 | 62 | same-strand | ATP synthase A chain |
| 4 | PF00430.20 | 1.0 | 93 | 98 | same-strand | ATP synthase B/B' CF(0) |
| 5 | PF00213.20 | 0.99 | 92 | 611.0 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00006.27 | 1.0 | 93 | 1545 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 7 | PF00306.29 | 1.0 | 93 | 1182 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 8 | PF02874.25 | 1.0 | 93 | 1545 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 9 | PF00231.21 | 1.0 | 93 | 2788 | same-strand | ATP synthase |
++ More..