Result : P25955
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ComG operon protein 3 |
| NCBI Accession ID | M29691.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3405 |
| Right | 3701 |
| Strand | + |
| Nucleotide Sequence | ATGAATGAGAAAGGATTTACACTTGTTGAAATGTTAATCGTGCTCTTTATTATTTCGATTTTGCTTTTAATTACGATACCGAACGTCACGAAACATAATCAAACCATTCAAAAAAAGGGCTGTGAAGGCTTACAAAACATGGTTAAGGCACAAATGACTGCATTTGAGCTTGATCATGAAGGACAAACTCCGAGCCTTGCCGATTTACAGTCAGAGGGCTATGTGAAAAAGGATGCTGTCTGTCCAAATGGTAAGCGCATTATCATCACCGGCGGAGAAGTTAAGGTTGAACATTAA |
| Sequence | MNEKGFTLVEMLIVLFIISILLLITIPNVTKHNQTIQKKGCEGLQNMVKAQMTAFELDHEGQTPSLADLQSEGYVKKDAVCPNGKRIIITGGEVKVEH |
| Source of smORF | Swiss-Prot |
| Function | Required for transformation and DNA binding. {ECO:0000269|Pubmed:9422590}. |
| Pubmed ID | 2507524 8969508 9384377 1968455 9422590 9723928 11744713 |
| Domain | CDD:226912 |
| Functional Category | Others |
| Uniprot ID | P25955 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2557673 | 2557969 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2430626 | 2430922 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2526842 | 2527138 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2431863 | 2432159 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2417429 | 2417725 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 1490115 | 1490381 | + | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 2509575 | 2509841 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 3699371 | 3699667 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 2354903 | 2355199 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 2830974 | 2831267 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2709118 | 2709411 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2555758 | 2556051 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 3123032 | 3123325 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2251956 | 2252249 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3034637 | 3034930 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 2474881 | 2475141 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 17 | 3384204 | 3384500 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 18 | 3291393 | 3291668 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 19 | 1491994 | 1492290 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 1972266 | 1972565 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 21 | 3439902 | 3440189 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 22 | 1663316 | 1663612 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 23 | 1474443 | 1474739 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 24 | 3389227 | 3389475 | - | NZ_CP053989.1 | Niallia circulans |
| 25 | 2460963 | 2461259 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 26 | 3477077 | 3477373 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 4260397 | 4260636 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 28 | 820480 | 820776 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 29 | 1372870 | 1373124 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 30 | 2475035 | 2475301 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 31 | 1902592 | 1902840 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 32 | 4491140 | 4491436 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 33 | 30963 | 31208 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 34 | 666669 | 666965 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 35 | 2472915 | 2473205 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 36 | 3341364 | 3341642 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 37 | 2224989 | 2225237 | - | NZ_CP012024.1 | Bacillus smithii |
| 38 | 1370108 | 1370347 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 39 | 2929159 | 2929443 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 40 | 1725275 | 1725559 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 41 | 1716202 | 1716480 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 42 | 3740646 | 3740885 | - | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT603683.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14038.8 | 0.71 | 30 | 1629.5 | same-strand | YqzE-like protein |
| 2 | PF14173.8 | 0.79 | 33 | 1172 | same-strand | ComG operon protein 7 |
| 3 | PF15980.7 | 0.93 | 39 | 724 | same-strand | Putative Competence protein ComGF |
| 4 | PF07963.14 | 0.86 | 36 | -3 | same-strand | Prokaryotic N-terminal methylation motif |
| 5 | PF00482.25 | 1.0 | 42 | 53.5 | same-strand | Type II secretion system (T2SS), protein F |
| 6 | PF00437.22 | 1.0 | 42 | 1074.0 | same-strand | Type II/IV secretion system protein |
| 7 | PF11117.10 | 0.69 | 29 | 3351 | opposite-strand | Protein of unknown function (DUF2626) |
++ More..