Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized 7.3 kDa protein in Eco57IM 5'region (ORF S) |
NCBI Accession ID | M74821.1 |
Organism | Escherichia coli |
Left | 696 |
Right | 884 |
Strand | + |
Nucleotide Sequence | ATGGCAAAAGGTGAATCAGAAAGAATCGTCCTAGAGGTTGAGCCAGAACTAAAAAAAGCTCTCTATTCAGTTCTTGCAATGGAACAAAAAACTCTTAAAGACTGGTTTGTTGATAAGGCTCAAGAACATATATGCGAGAAAAAATCAGAGCTCATAGAGAGATTTTCGAAGGTAGACAATGAAATTTAA |
Sequence | MAKGESERIVLEVEPELKKALYSVLAMEQKTLKDWFVDKAQEHICEKKSELIERFSKVDNEI |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 1334261 |
Domain | |
Functional Category | Others |
Uniprot ID | P25287 |
ORF Length (Amino Acid) | 62 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 318375 | 318563 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
2 | 3854951 | 3855139 | + | NZ_CP032487.1 | Yersinia hibernica |
3 | 504430 | 504618 | - | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07669.13 | 1.0 | 3 | 2275.0 | opposite-strand | Eco57I restriction-modification methylase |
2 | PF02384.18 | 0.67 | 2 | 2275.0 | opposite-strand | N-6 DNA Methylase |