Result : P25287
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 7.3 kDa protein in Eco57IM 5'region (ORF S) |
| NCBI Accession ID | M74821.1 |
| Organism | Escherichia coli |
| Left | 696 |
| Right | 884 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAAGGTGAATCAGAAAGAATCGTCCTAGAGGTTGAGCCAGAACTAAAAAAAGCTCTCTATTCAGTTCTTGCAATGGAACAAAAAACTCTTAAAGACTGGTTTGTTGATAAGGCTCAAGAACATATATGCGAGAAAAAATCAGAGCTCATAGAGAGATTTTCGAAGGTAGACAATGAAATTTAA |
| Sequence | MAKGESERIVLEVEPELKKALYSVLAMEQKTLKDWFVDKAQEHICEKKSELIERFSKVDNEI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 1334261 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P25287 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 318375 | 318563 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 2 | 3854951 | 3855139 | + | NZ_CP032487.1 | Yersinia hibernica |
| 3 | 504430 | 504618 | - | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP060401.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07669.13 | 1.0 | 3 | 2275.0 | opposite-strand | Eco57I restriction-modification methylase |
| 2 | PF02384.18 | 0.67 | 2 | 2275.0 | opposite-strand | N-6 DNA Methylase |
++ More..