Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized 11.6 kDa protein in scrR 3'region (ORF5) |
NCBI Accession ID | M35009.1 |
Organism | Vibrio alginolyticus |
Left | 791 |
Right | 1090 |
Strand | + |
Nucleotide Sequence | ATGTACCACCACCAGCAAAAGATACGGAAGCATTGGCATCGCACTGTTTTATTTTTCAGTGTCGCGTTGCTGATCGCTTGGAACTTTGCGGTAATCCTTCATCAAGTTGATCTGACTCCCGAACACCACACACACCATCATTGCCAGCTATTTTCTGGGGTTCAGCACGGCATAGCCAAAGCTCAACCGACCCTATCGACGCCAACATTTACGCGCATCCAATACCATGATGTCTTTCAGCGCCTTGTTAATAGTGAAGACATTCGTGGTGCAGCTCGTGCCCCGCCTTATTTTGCTTAA |
Sequence | MYHHQQKIRKHWHRTVLFFSVALLIAWNFAVILHQVDLTPEHHTHHHCQLFSGVQHGIAKAQPTLSTPTFTRIQYHDVFQRLVNSEDIRGAARAPPYFA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10795. Profile Description: Protein of unknown function (DUF2607). This family is conserved in Gammaproteobacteria. The function is not known. |
Pubmed ID | 2060795 |
Domain | CDD:402431 |
Functional Category | Others |
Uniprot ID | P24509 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 97904 | 98203 | + | NC_013456.1 | Vibrio antiquarius |
2 | 2969126 | 2969425 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
3 | 308145 | 308444 | - | NZ_CP030788.1 | Vibrio campbellii |
4 | 2592797 | 2593054 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
5 | 1927887 | 1928138 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
6 | 1515392 | 1515640 | + | NZ_CP019959.1 | Vibrio owensii |
7 | 515823 | 516122 | - | NZ_CP009467.1 | Vibrio harveyi |
8 | 2794496 | 2794795 | + | NZ_CP018312.1 | Vibrio rotiferianus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04357.15 | 1.0 | 8 | 3741.0 | opposite-strand | TamB, inner membrane protein subunit of TAM complex |
2 | PF01103.25 | 1.0 | 8 | 2032.0 | opposite-strand | Omp85 superfamily domain |
3 | PF17243.4 | 1.0 | 8 | 2032.0 | opposite-strand | POTRA domain TamA domain 1 |
4 | PF01625.23 | 1.0 | 8 | 1227.0 | same-strand | Peptide methionine sulfoxide reductase |
5 | PF06526.14 | 1.0 | 8 | 977.5 | opposite-strand | Protein of unknown function (DUF1107) |
6 | PF09695.12 | 1.0 | 8 | 209.5 | same-strand | Bacterial protein of unknown function (YtfJ HI0045) |
7 | PF00005.29 | 1.0 | 8 | 854.0 | same-strand | ABC transporter |
8 | PF02687.23 | 1.0 | 8 | 1579.0 | same-strand | FtsX-like permease family |
9 | PF12704.9 | 1.0 | 8 | 1579.0 | same-strand | MacB-like periplasmic core domain |
10 | PF11736.10 | 1.0 | 8 | 2843.5 | same-strand | Protein of unknown function (DUF3299) |
11 | PF10986.10 | 0.62 | 5 | 99 | same-strand | Protein of unknown function (DUF2796) |