Result : P24509
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 11.6 kDa protein in scrR 3'region (ORF5) |
| NCBI Accession ID | M35009.1 |
| Organism | Vibrio alginolyticus |
| Left | 791 |
| Right | 1090 |
| Strand | + |
| Nucleotide Sequence | ATGTACCACCACCAGCAAAAGATACGGAAGCATTGGCATCGCACTGTTTTATTTTTCAGTGTCGCGTTGCTGATCGCTTGGAACTTTGCGGTAATCCTTCATCAAGTTGATCTGACTCCCGAACACCACACACACCATCATTGCCAGCTATTTTCTGGGGTTCAGCACGGCATAGCCAAAGCTCAACCGACCCTATCGACGCCAACATTTACGCGCATCCAATACCATGATGTCTTTCAGCGCCTTGTTAATAGTGAAGACATTCGTGGTGCAGCTCGTGCCCCGCCTTATTTTGCTTAA |
| Sequence | MYHHQQKIRKHWHRTVLFFSVALLIAWNFAVILHQVDLTPEHHTHHHCQLFSGVQHGIAKAQPTLSTPTFTRIQYHDVFQRLVNSEDIRGAARAPPYFA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10795. Profile Description: Protein of unknown function (DUF2607). This family is conserved in Gammaproteobacteria. The function is not known. |
| Pubmed ID | 2060795 |
| Domain | CDD:402431 |
| Functional Category | Others |
| Uniprot ID | P24509 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 97904 | 98203 | + | NC_013456.1 | Vibrio antiquarius |
| 2 | 2969126 | 2969425 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 3 | 308145 | 308444 | - | NZ_CP030788.1 | Vibrio campbellii |
| 4 | 2592797 | 2593054 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 5 | 1927887 | 1928138 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 6 | 1515392 | 1515640 | + | NZ_CP019959.1 | Vibrio owensii |
| 7 | 515823 | 516122 | - | NZ_CP009467.1 | Vibrio harveyi |
| 8 | 2794496 | 2794795 | + | NZ_CP018312.1 | Vibrio rotiferianus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031781.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04357.15 | 1.0 | 8 | 3741.0 | opposite-strand | TamB, inner membrane protein subunit of TAM complex |
| 2 | PF01103.25 | 1.0 | 8 | 2032.0 | opposite-strand | Omp85 superfamily domain |
| 3 | PF17243.4 | 1.0 | 8 | 2032.0 | opposite-strand | POTRA domain TamA domain 1 |
| 4 | PF01625.23 | 1.0 | 8 | 1227.0 | same-strand | Peptide methionine sulfoxide reductase |
| 5 | PF06526.14 | 1.0 | 8 | 977.5 | opposite-strand | Protein of unknown function (DUF1107) |
| 6 | PF09695.12 | 1.0 | 8 | 209.5 | same-strand | Bacterial protein of unknown function (YtfJ HI0045) |
| 7 | PF00005.29 | 1.0 | 8 | 854.0 | same-strand | ABC transporter |
| 8 | PF02687.23 | 1.0 | 8 | 1579.0 | same-strand | FtsX-like permease family |
| 9 | PF12704.9 | 1.0 | 8 | 1579.0 | same-strand | MacB-like periplasmic core domain |
| 10 | PF11736.10 | 1.0 | 8 | 2843.5 | same-strand | Protein of unknown function (DUF3299) |
| 11 | PF10986.10 | 0.62 | 5 | 99 | same-strand | Protein of unknown function (DUF2796) |
++ More..